DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPC5 and LOC100490872

DIOPT Version :9

Sequence 1:NP_543022.1 Gene:PABPC5 / 140886 HGNCID:13629 Length:382 Species:Homo sapiens
Sequence 2:XP_002932728.2 Gene:LOC100490872 / 100490872 -ID:- Length:449 Species:Xenopus tropicalis


Alignment Length:234 Identity:80/234 - (34%)
Similarity:121/234 - (51%) Gaps:29/234 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   150 VHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTN---VFVKNIGDDID 211
            |||:....|.|.: |...|.||            |...::....|..:.|.   ::|||...:||
 Frog     7 VHFEIQVEAKRVV-HAVDVLLN------------ESGMSDEHVNDTESKTKTCPIYVKNFVKEID 58

Human   212 DEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQK 276
            ::   :.|.:.|  .|.|:|.:..|:...||.:.:...:.|.:||..:.|..|     |:.:|:.
 Frog    59 ED---DFFGKCG--ASTKIINNDCGQQTEFGLLPFNKQKDAIRAVDKMKGMDI-----YLAQAKI 113

Human   277 KIERLAELRRRFERLRLKEKSRPPGVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGK 341
            |.:|..|..::.|.|   .|.|...|.:|:|||...|:|.:|.:||:.||.|:.||||.|.|:.|
 Frog   114 KEKRQTEFSKKPEPL---HKPRYNSVNLYVKNLSYEIDDYRLNKEFAPFGIITSAKVMREGGRSK 175

Human   342 GFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTLGQARR 380
            |||.||||:..||.||:..|||:|:.||||:|...|.::
 Frog   176 GFGFVCFSTPAEARKALSGMNGKILASKPLYVAWAQRKQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPC5NP_543022.1 PABP-1234 22..>379 CDD:130689 80/231 (35%)
LOC100490872XP_002932728.2 PABP-1234 <7..431 CDD:130689 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D225999at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.