DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLDC2 and mtd

DIOPT Version :10

Sequence 1:NP_542195.1 Gene:TLDC2 / 140711 HGNCID:16112 Length:215 Species:Homo sapiens
Sequence 2:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster


Alignment Length:170 Identity:82/170 - (48%)
Similarity:114/170 - (67%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    43 DPTVPQLTEASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLV 107
            |..:|.|...:::|:.....:|..|.|.|..|:.|||:|.||:.||:|.||||:|.....|||:|
  Fly  1172 DFPIPDLIGKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIV 1236

Human   108 LRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSG 172
            :.|.:..:|||.:|.::.:|..||||||:.|:.|:|..|||.|||.|.:|:||:::||.:|:|.|
  Fly  1237 IEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDG 1301

Human   173 RFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAW 212
            ||||||||||.:|.|..|.|:.||.||.||.|.|:.||.|
  Fly  1302 RFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECW 1341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLDC2NP_542195.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 1/2 (50%)
TLDc 53..212 CDD:214733 78/158 (49%)
mtdNP_001246928.1 LysM <250..371 CDD:440998
TLDc 1182..1344 CDD:214733 79/160 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.