DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F2rl2 and TkR86C

DIOPT Version :9

Sequence 1:NP_034300.3 Gene:F2rl2 / 14064 MGIID:1298208 Length:369 Species:Mus musculus
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:299 Identity:73/299 - (24%)
Similarity:135/299 - (45%) Gaps:54/299 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    99 IYILLFVVGVPANIVTLWKL----SLRTKSISLVIFHTNLAIADLLF----CVTLPFKIAYHLNG 155
            |:.|:..|.:..|.:.||.:    |:||.:   ..|..||:|||||.    ||   |...:.|| 
  Fly    89 IFGLMMFVAIAGNGIVLWIVTGHRSMRTVT---NYFLLNLSIADLLMSSLNCV---FNFIFMLN- 146

Mouse   156 NNWVFGEVTCRITTVVFYGNMYCAILILTCMGINRYLATAHPFTYQKLPKRSFSMLMCGMVWVMV 220
            ::|.||.:.|.|...|....:..::..|..:..:||:|..||.. ::..:|...:::. ::|.:.
  Fly   147 SDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLK-RRTSRRKVRIILV-LIWALS 209

Mouse   221 FLYMLPFV----ILKQEYHLVHSEITTCHDVVDACESPSSFRFY-YFVSLAFFGFLIPFVIIIFC 280
            .:...|.:    |:.:.|:...|. |.|..:......|:|...| |.:.:....:.||.::::.|
  Fly   210 CVLSAPCLLYSSIMTKHYYNGKSR-TVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLIC 273

Mouse   281 YTTL-----------------IHKLKSKDRIWLGYIKAVLLILVIFTICFAPTNIILVIHHANYY 328
            |:.:                 :..:|||.::    ::..:.|:.||.||:.|.::..:     |.
  Fly   274 YSLMGRVLWGSRSIGENTDRQMESMKSKRKV----VRMFIAIVSIFAICWLPYHLFFI-----YA 329

Mouse   329 YHN-----TDSLYFMYLIALCLGSLNSCLDPFLYFVMSK 362
            |||     |..:..|||....|...|:.::|.:|:.|:|
  Fly   330 YHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F2rl2NP_034300.3 7tm_4 104..>312 CDD:304433 54/237 (23%)
7tm_1 112..357 CDD:278431 66/279 (24%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 72/296 (24%)
7tm_1 100..363 CDD:278431 67/281 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.