DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRX and CG9876

DIOPT Version :10

Sequence 1:NP_000545.1 Gene:CRX / 1406 HGNCID:2383 Length:299 Species:Homo sapiens
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:116 Identity:48/116 - (41%)
Similarity:61/116 - (52%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    37 RKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQ-QRQQ 100
            ||.||.||||:.:||..||.:|.:|.|||.:.|||:|.|::|.|:||||||:|||||.|: :|..
  Fly   115 RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSV 179

Human   101 QKQQQQPPGGQAKARPAK---RKAGTSPRPSTDVCPDPLGISDSYSPPLPG 148
            ..:.......|....|..   .|....|.|.    |.|        ||.||
  Fly   180 GSRTLLDTAPQLVPAPISNNMHKYANMPHPH----PQP--------PPPPG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRXNP_000545.1 Homeodomain 40..93 CDD:459649 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..155 14/60 (23%)
TF_Otx 164..249 CDD:427350
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 33/55 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.