DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRX and otp

DIOPT Version :9

Sequence 1:NP_000545.1 Gene:CRX / 1406 HGNCID:2383 Length:299 Species:Homo sapiens
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:265 Identity:73/265 - (27%)
Similarity:105/265 - (39%) Gaps:88/265 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    38 KQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQK 102
            ||:|.||.||.:||.|||..|:||.|||::.|||:|::|.|.||||||||:|||||.:::::   
  Fly   115 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKK--- 176

Human   103 QQQQPPGGQAKARPAKRKAGTSPRPSTDVCPDPLGISDSYSPPLPGPSGSPTTAVA--------- 158
                                     :|:|...|..:..|:..|   |.|:..|.:|         
  Fly   177 -------------------------TTNVFRTPGALLPSHGLP---PFGANITNIAMGDGLCGTG 213

Human   159 --------------TVSIWSPASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYG 209
                          |.........|||..:..:|| .||.::                  .||.|
  Fly   214 MFGGDRWSVGVNPMTAGFGQLNQSSPLSSSLNSGL-NSGINM------------------GSALG 259

Human   210 SPSSYFSGLDPYLSPMVPQ--LGGPALSPLSGPS-------------VGPSLAQSPTSLSGQSYG 259
            :.|....||:.....|:.|  :||.:..|...||             ..|.|:..|.|...:..|
  Fly   260 AGSYQHYGLNALGDSMMYQHSVGGVSCGPSGSPSATTPPNMNSCSSVTPPPLSAQPNSSQNELNG 324

Human   260 AYSPV 264
            ...|:
  Fly   325 EPMPL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRXNP_000545.1 Homeobox 43..93 CDD:395001 32/49 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..155 8/61 (13%)
TF_Otx 166..249 CDD:397546 22/97 (23%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 29/47 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5000
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.