DRSC - DRSC Integrative Ortholog Prediction Tool

DRSC/TRiP Functional Genomics Resources

powered by:

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CRX and Vsx2

DIOPT Version :10

Sequence 1:	NP_000545.1	Gene:	CRX / 1406	HGNCID:	2383	Length:	299	Species:	Homo sapiens
Sequence 2:	NP_001284897.1	Gene:	Vsx2 / 31469	FlyBaseID:	FBgn0263512	Length:	645	Species:	Drosophila melanogaster

Alignment Length:	41	Identity:	10/41 - (24%)
Similarity:	14/41 - (34%)	Gaps:	15/41 - (36%)

- Green bases have known domain annotations that are detailed below.

Human   225 DAGYHMECLD---------PPLQEVPVD------EWFCPEC 250
            |..||:.|.|         .|.::..|:      ||....|
  Fly   140 DCNYHVVCFDYRGYGDSEGTPTEKGIVEDTKTVYEWLKENC 180

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CRX	NP_000545.1	Homeodomain	40..93	CDD:459649
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	93..155
		TF_Otx	164..249	CDD:427350	9/38 (24%)
Vsx2	NP_001284897.1	Homeodomain	230..287	CDD:459649
Vsx2	NP_001284897.1	OAR	556..572	CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.