DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and CG11836

DIOPT Version :9

Sequence 1:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:326 Identity:113/326 - (34%)
Similarity:174/326 - (53%) Gaps:38/326 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse   167 YFLGNDGKSCISTAPFPCGKITTGRRKRSVALNTS----DSELDLEDALLDEDFLSPTENPIELL 227
            |..|.:....|:|       |.||..||     ||    |:...:...:.:...||.||:.:|  
  Fly    24 YSKGFNESDAINT-------IHTGHNKR-----TSKFLFDTIFRISSGVSNAFGLSDTEDEVE-- 74

Mouse   228 NLNETQPERS-------SDDLVRIVGGRECKDGECPWQALLINEDNEGFCGGTILNEFYILTAAH 285
             ..|....::       |::.:|||||:.....:.||.|.:: .|.:..|||::|.:.|:|:|||
  Fly    75 -YTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIV-YDGKFHCGGSLLTKDYVLSAAH 137

Mouse   286 CLHQARRFKVRV--GDRNTE-KEEGNEMVHEVDVVIKHNKFQRDTYDYDIAVLRLKTPITFRMNV 347
            |:.:.|:.|:||  ||.:.| ..|...:...|..||||..|..|||:.|||:|||:.||:|...:
  Fly   138 CVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKII 202

Mouse   348 APACLPQKDWAESTLMTQKTGIVSGFGRTHEKGRQSNILKMLEVPYVDRNTCKLS--TSFSITQN 410
            .|.|||:.::..:    .:.|.|.|:|||.|.|...:|:..::||.:....|:..  .|..||.:
  Fly   203 KPICLPRYNYDPA----GRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSS 263

Mouse   411 MFCAGYEAKLEDACQGDSGGPHVTRFKNTYYVTGIVSWGEGCARKGKYGIYTKVTTFLKWIDRSM 475
            |.|||..:.  |:||||||||.:......|::.||||||.||.|:|..|:|::|:.|:.||..::
  Fly   264 MLCAGRPSM--DSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326

Mouse   476 K 476
            :
  Fly   327 E 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:291342 2/8 (25%)
Tryp_SPc 243..471 CDD:214473 92/232 (40%)
Tryp_SPc 244..473 CDD:238113 93/233 (40%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 93/234 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3752
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H30976
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11114
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4142
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.