DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and Sp7

DIOPT Version :9

Sequence 1:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:410 Identity:119/410 - (29%)
Similarity:173/410 - (42%) Gaps:90/410 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   105 SPCQNQGACRDGIGGYTC-----TCSEGFEGKNCELFVRKLCRLDNGDC-DQFCREEQNSVVCSC 163
            :|.|.||.|   :..|.|     ...:.:.......|:|      |..| |...|:   ..|| |
  Fly    33 NPNQKQGQC---LSIYDCQSLLSVIQQSYVSPEDRTFLR------NSQCLDGVGRQ---PYVC-C
 84

Mouse   164 ASGYFLGNDGKSCISTAPFPCGKITTGRRKRSVALNTSDSELDLEDALLDEDFLSPTENPIELLN 228
            .|....|:  :...|.||.|   .||....|.     .|.:..|.:.|.......|.....::.|
  Fly    85 TSDRSFGS--QEATSAAPPP---TTTSSSSRG-----QDGQAGLGNLLPSPPKCGPHSFSNKVYN 139

Mouse   229 LNETQPERSSDDLVRIVGGRECKDGECPWQALLINEDNEG----FCGGTILNEFYILTAAHCLHQ 289
            .|:|..:                  |..|.|||...||.|    .|||:::|..|:||||||:..
  Fly   140 GNDTAID------------------EFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIG 186

Mouse   290 ARRFK------VRVGDRNTEKEEGNEMVHEVDVVIKHNKFQ--------RDTYD-------YDIA 333
            |...:      ||:|:.:|.|:     |..:|.:......|        ...||       :|||
  Fly   187 AVETEVGHLTTVRLGEYDTSKD-----VDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIA 246

Mouse   334 VLRLKTPITFRMNVAPACLPQKDWAESTLMTQKTG---IVSGFGRTHEKGRQSNILKMLEVPYVD 395
            :|||..|:.....:.|.|||    ..||.|...||   :|||:||| ...|:|.|.:.|::|..|
  Fly   247 LLRLDRPVVLNEYIQPVCLP----LVSTRMAINTGELLVVSGWGRT-TTARKSTIKQRLDLPVND 306

Mouse   396 RNTC--KLST-SFSITQNMFCAGYEAKLEDACQGDSGGPHVTR-FKNTYYVTGIVSWGEGCARKG 456
            .:.|  |.:| :..:..:..|.|.|. ..|:|.||||||.:.| |...:|..|:||:|..|..:|
  Fly   307 HDYCARKFATRNIHLISSQLCVGGEF-YRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEG 370

Mouse   457 KYGIYTKVTTFLKWIDRSMK 476
            ..|:||:|..::.||..:::
  Fly   371 WPGVYTRVADYMDWIVETIR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011 7/33 (21%)
FXa_inhibition 141..176 CDD:291342 9/35 (26%)
Tryp_SPc 243..471 CDD:214473 85/259 (33%)
Tryp_SPc 244..473 CDD:238113 87/260 (33%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855 15/63 (24%)
Tryp_SPc 136..385 CDD:214473 88/277 (32%)
Tryp_SPc 137..388 CDD:238113 90/279 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.