DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ankrd6 and dgo

DIOPT Version :9

Sequence 1:NP_001012453.1 Gene:Ankrd6 / 140577 MGIID:2154278 Length:712 Species:Mus musculus
Sequence 2:NP_610614.1 Gene:dgo / 36139 FlyBaseID:FBgn0086898 Length:927 Species:Drosophila melanogaster


Alignment Length:665 Identity:160/665 - (24%)
Similarity:257/665 - (38%) Gaps:195/665 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    72 DDGDQTALHRATVVGNTEILTALIREGC-ALDRQDKDGNTALHEAAWHGFSQSAKLL-------V 128
            |..:.|:||.|...|:...:..|:.... .|.|:...|||.|||||..|||:..||:       .
  Fly    22 DSSNWTSLHEAVAAGDDRRVEGLLFSNADRLARESVQGNTPLHEAASRGFSRCVKLICTPPTPPA 86

Mouse   129 KAGANVLAR--------------------------------NKAGNTALHLACQNSHSQSTRILL 161
            .:|....|:                                |..|.:|||||.||.|:||:|.||
  Fly    87 SSGVGKAAKGQKDKDKDKNKGRVKVAHQTIEALHNSALGIANNEGLSALHLAAQNGHNQSSRELL 151

Mouse   162 LGGSRADLKNNAGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQAGDTALHVAAALNHKKVVKVL 226
            |.|:..|::||.|||.||.|.||.|..|.|:||:|.|..::.|..||||||:..|:..:|:.::|
  Fly   152 LAGADPDVRNNYGDTPLHTACRYGHAGVSRILLSALCDPNKTNLNGDTALHITCAMGRRKLTRIL 216

Mouse   227 LEAGADTTIVNNAGQTPLETARYHNNPEVALLLTKAPQILRFSRGRSLRKRRERLKEERRAQSVP 291
            |||.|...|.|..|..|:..|...|..|:..:|         :..:.:|.|:|:.||        
  Fly   217 LEADARLGIKNAQGDCPMHIAIRKNYREIIEIL---------NTPKKIRNRKEKPKE-------- 264

Mouse   292 RDEVAQSKGSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRKSRPEVSALSDPTPAADQ 356
                   .||                              |.|:.|.:.|..|            
  Fly   265 -------GGS------------------------------RSDKDRDRERDVV------------ 280

Mouse   357 QPGHQKNLHSHHHPKKKSRHRCWSP------PPPHGFRAYQLYTLYR-----GED------GKVM 404
                .|.::             |||      |.|..|.:.:|.||.:     ||.      |.:.
  Fly   281 ----DKGIN-------------WSPYGCHYFPDPRAFPSPKLETLPKEPLKSGEQYFLDLAGHIH 328

Mouse   405 QAPI---KGCRCEPLINKLENQLEATVEEIRAELGSVQDKVNAKLGQMESKTQHQMCVLDKLMVE 466
            :.|:   ..|.|.|....:||:|....:.::..:...::::..|:..:..||..|:..|.:.|:|
  Fly   329 KGPVSVGNTCYCGPFFRHIENKLNCNRKSLKKYVHKTKERLGHKVQALAIKTNDQIEQLTRTMIE 393

Mouse   467 RLSAERTECMNRLQQHAAAEKQEGEKRQMSLVDELKA----WCMLKIQSLEL--------RLSG- 518
                :|..|.:: :||.:...:.||..:.:...:.|:    ..|.:.:||||        ||:. 
  Fly   394 ----DRLRCESK-RQHLSEFLRRGEPMRSTFDQQNKSSRIERTMSRCRSLELLENNHEGGRLTNS 453

Mouse   519 -----------ESRTFRAKSTPPPSDSTPAVDQPVVAAGPGAASDSSSQVVRPKDKALNASAAHS 572
                       |:...|:......|||....::         |.|.....|..||:.        
  Fly   454 RSVDVLEDQAVEAIVHRSAEVQVDSDSDDDSNE---------ARDEEEAEVGDKDQV-------- 501

Mouse   573 HQQELPPSDCTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPSGQQ 637
             |:|..|.:  .|.|.::|. ...:..::.|..:.:.|...:  |..:.:.:.|..:.|.|....
  Fly   502 -QEEAEPEE--HSKLDELKL-DFLKVSERLGVLLEKTTLIME--RDSEQESKRQLSSLSPPYNPH 560

Mouse   638 PSAASSDVRDASQAL 652
            |.|.|:.:|:..:::
  Fly   561 PRAESAQLREDKESV 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ankrd6NP_001012453.1 ANK 1 9..38
PHA03095 29..>265 CDD:222980 81/232 (35%)
ANK repeat 41..72 CDD:293786 160/665 (24%)
ANK 2 41..70
ANK repeat 74..105 CDD:293786 8/31 (26%)
ANK 3 74..103 7/29 (24%)
ANK repeat 107..138 CDD:293786 15/69 (22%)
ANK 4 107..136 14/35 (40%)
ANK 5 140..169 16/28 (57%)
ANK repeat 141..171 CDD:293786 17/29 (59%)
ANK repeat 173..204 CDD:293786 15/30 (50%)
ANK 6 173..202 15/28 (54%)
ANK repeat 206..237 CDD:293786 14/30 (47%)
ANK 7 206..235 13/28 (46%)
ANK 8 239..268 6/28 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..382 15/110 (14%)
DUF2967 520..>643 CDD:371408 23/122 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 521..647 24/125 (19%)
dgoNP_610614.1 ANK 22..184 CDD:238125 55/161 (34%)
ANK repeat 24..55 CDD:293786 7/30 (23%)
Ank_2 29..161 CDD:289560 40/131 (31%)
ANK repeat 59..128 CDD:293786 15/68 (22%)
ANK 126..249 CDD:238125 56/122 (46%)
ANK repeat 130..161 CDD:293786 17/30 (57%)
Ank_2 135..227 CDD:289560 47/91 (52%)
ANK repeat 163..194 CDD:293786 15/30 (50%)
ANK repeat 196..227 CDD:293786 14/30 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842755
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BHC7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111903
Panther 1 1.100 - - LDO PTHR24203
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10493
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.