DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYO3B and MKK2

DIOPT Version :9

Sequence 1:XP_011508956.1 Gene:MYO3B / 140469 HGNCID:15576 Length:1386 Species:Homo sapiens
Sequence 2:NP_015185.1 Gene:MKK2 / 855963 SGDID:S000006061 Length:506 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:96/294 - (32%)
Similarity:146/294 - (49%) Gaps:21/294 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    42 IGKGTYGKVYKVTNKRDGSLAAVKILDPVSDMDEEIEAEYNILQFLPNHPN--VVKFYGMFYKAD 104
            :|:|..|.|.|...|....:.|:|.::.::...|..:..:..|||..:..:  :|::||||....
Yeast   220 LGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQ 284

Human   105 HCVGGQLWLVLELCNGGSVTELVKGLLRCGQRLDEAMISYILYGALLGLQHLHNNRIIHRDVKGN 169
               ...:::.:|...|.|:....|.||:.|.|:.|.:|..|....|.||.:||..::||||:|..
Yeast   285 ---SSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQ 346

Human   170 NILLTTEGGVKLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQYDSSYDARCDVWSLGIT 234
            ||||..:|.:||.|||||.:..::...  |..||.|:||||.|     ....|...|||||||:|
Yeast   347 NILLNEKGEIKLCDFGVSGEAVNSLAM--TFTGTSFYMAPERI-----QGQPYSVTCDVWSLGLT 404

Human   235 AIELGDG------DPPLFDMHPVKTLFKIPRNPPPTLLHPE---KWCEEFNHFISQCLIKDFERR 290
            .:|:..|      |....::.|::.|..|....|.....||   .|.:.|..||..||.||...|
Yeast   405 LLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARER 469

Human   291 PSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQK 324
            ||...:|.||:|.|...|.:.:::.:.|..:.:|
Yeast   470 PSPRQMLKHPWIVGQMKKKVNMERFVKKCWEKEK 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYO3BXP_011508956.1 STKc_myosinIIIB_N 13..303 CDD:270808 91/271 (34%)
S_TKc 36..302 CDD:214567 91/270 (34%)
MYSc 355..1062 CDD:214580
MYSc_Myo3 366..1055 CDD:276830
MKK2NP_015185.1 PKc_Pek1_like 212..499 CDD:270793 95/288 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.