DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYO3B and ppk11

DIOPT Version :9

Sequence 1:XP_011508956.1 Gene:MYO3B / 140469 HGNCID:15576 Length:1386 Species:Homo sapiens
Sequence 2:NP_594517.1 Gene:ppk11 / 2541473 PomBaseID:SPAC2C4.14c Length:312 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:102/267 - (38%)
Similarity:150/267 - (56%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    39 IETIGKGTYGKVYKVTNKRDGSLAAVKI--LDPVSDMDEEIEAEYNILQFLPNHPNVVKFYGMFY 101
            ::.||:|::|.|::..:.....:.|:|:  ||...|..|.:..|.|.|..| |..::.|:|..|.
pombe     9 LQLIGQGSFGSVFRAQDVESSKIVALKVVDLDATKDQIETLTQEINFLIDL-NSVHITKYYASFV 72

Human   102 KADHCVGGQLWLVLELCNGGSVTELVKGLLRCGQRLDEAMISYILYGALLGLQHLHNNRIIHRDV 166
            .     |.:||:.:|.|:|||..:    ||:......|.:|:.::...|..|.:||....:|||:
pombe    73 D-----GFRLWITMEYCDGGSCLD----LLKLSGTFSERVIAEVMRQVLEALVYLHGQGKMHRDI 128

Human   167 KGNNILLTTEGGVKLVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQYDSSYDARCDVWSL 231
            |..|||...:|.|||.|||||.||.|.|.:.:..|||||||||||:.     .:.|:.:.|:|||
pombe   129 KAANILTMKDGLVKLADFGVSGQLESLRDKNDDFVGTPFWMAPEVVK-----QTGYNYKADIWSL 188

Human   232 GITAIELGDGDPPLFDMHPVKTLFKIPRNPPPTLLHPEKWCEEFNHFISQCLIKDFERRPSVTHL 296
            ||||.||..|:||...:||:|.|..||::.||: |...|:...|..|:|.||.|:.:.|.:..:|
pombe   189 GITAYELATGEPPYSGIHPMKVLLLIPKHSPPS-LERSKFSRAFCDFVSNCLKKNPKDRATAEYL 252

Human   297 LDHPFIK 303
            ..|.|||
pombe   253 SKHKFIK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYO3BXP_011508956.1 STKc_myosinIIIB_N 13..303 CDD:270808 100/265 (38%)
S_TKc 36..302 CDD:214567 99/264 (38%)
MYSc 355..1062 CDD:214580
MYSc_Myo3 366..1055 CDD:276830
ppk11NP_594517.1 STKc_MST3_like 4..278 CDD:270786 102/267 (38%)
S_TKc 6..258 CDD:214567 99/264 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.