DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and BDKRB1

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_000701.2 Gene:BDKRB1 / 623 HGNCID:1029 Length:353 Species:Homo sapiens


Alignment Length:383 Identity:96/383 - (25%)
Similarity:164/383 - (42%) Gaps:82/383 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EPAAATQS-IYPHSATL----------------FAAISACVFVTIGVLGNLITLLALLKSPTIRE 68
            |..::.|| ::|.:||.                ...||.|.|   |:||||..||..| .|..:.
Human     9 ELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFF---GLLGNLFVLLVFL-LPRRQL 69

  Fly    69 HATTAFVISLSISDLLFCSFSLPLTAVRFF-QESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITL 132
            :....::.:|:.|||:|. ..||..|...: |.:|.||..||::...:...|:.:|:..:|.|:.
Human    70 NVAEIYLANLAASDLVFV-LGLPFWAENIWNQFNWPFGALLCRVINGVIKANLFISIFLVVAISQ 133

  Fly   133 NRYILIACH---SRYSQIYKPKFITLQLLFVWAVSFLLLLPPILGIWGEMGLDEATFSCTILKKE 194
            :||.::. |   ||..|..:...:|..|  :|.|..||.:|..|....:...|....:|.:|...
Human   134 DRYRVLV-HPMASRRQQRRRQARVTCVL--IWVVGGLLSIPTFLLRSIQAVPDLNITACILLLPH 195

  Fly   195 -----GRSIKKTLFVIGFLLPCLVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSY 254
                 .|.::  |.::||||| |..||.::...:..|..::::             |.:..||  
Human   196 EAWHFARIVE--LNILGFLLP-LAAIVFFNYHILASLRTREEV-------------SRTRCGG-- 242

  Fly   255 MTTTCTRKAREDNRLTVMMVTIFLCFLVCFLP----LMLANVVDDERNTSYPWLHII------AS 309
                     |:|::.|.:::|:.:.||||:.|    ..|..:...:......|...|      |:
Human   243 ---------RKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLAN 298

  Fly   310 VMAWASSVINPIIYAASNRNYSESIFYFRVAYYKIFALLKFWGEPLSPMPSRNYHQSK 367
            ..|:.:|.:||:||          :|..|:...|::.|.| ...|.|..|..:.|:.:
Human   299 FFAFTNSSLNPVIY----------VFVGRLFRTKVWELYK-QCTPKSLAPISSSHRKE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 73/289 (25%)
BDKRB1NP_000701.2 7tmA_BK-1 38..323 CDD:320502 83/329 (25%)
TM helix 1 40..64 CDD:320502 12/27 (44%)
TM helix 2 73..94 CDD:320502 7/21 (33%)
TM helix 3 111..133 CDD:320502 4/21 (19%)
TM helix 4 156..172 CDD:320502 6/17 (35%)
TM helix 5 200..223 CDD:320502 10/25 (40%)
TM helix 6 249..271 CDD:320502 7/21 (33%)
TM helix 7 291..316 CDD:320502 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.