DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and aplnra

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001068573.1 Gene:aplnra / 561935 ZFINID:ZDB-GENE-060929-512 Length:362 Species:Danio rerio


Alignment Length:391 Identity:93/391 - (23%)
Similarity:161/391 - (41%) Gaps:81/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TGYFQDADMQMDEPAAATQSIYPHSATLFAAISACVFVTIGVLGNLITLLALLKSPTIREHATTA 73
            ||| .|:.....|        :..|.:|...:...:|: :|:.||.:.:..:.::.: :..|...
Zfish    16 TGY-NDSGCDYSE--------WEPSYSLIPVLYMLIFI-LGLSGNGVVIFTVWRAKS-KRRAADV 69

  Fly    74 FVISLSISDLLFCSFSLPLTAV-RFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYIL 137
            ::.:|:::||.|. .:|||.|| ......|.||..||||...:...|:..|:..:..::.:||:.
Zfish    70 YIGNLALADLTFV-ITLPLWAVYTALGYHWPFGVALCKISSYVVLVNMYASVFCLTCLSFDRYLA 133

  Fly   138 IACHSRYSQIYKPKFITLQLL-FVWAVSFLLLLPPIL--GIWGEMGLDEAT----FSCTILKKE- 194
            |. ||..|...:.:...|..| .:|.:|.||.:|.:|  ....:.|.:..|    ||...|.:: 
Zfish   134 IV-HSLSSGRLRSRATMLASLGAIWFLSCLLAVPTLLFRTTVDDTGSNRTTCAMDFSLVTLNQDH 197

  Fly   195 ------GRSIKKTLFVIGFLLPCLVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGS 253
                  |.|:..:  .:|||||.|.:.|.|..|..||......:|..|                 
Zfish   198 ESLWIAGLSLSSS--ALGFLLPFLAMTVCYCFIGCTVTRHFSHLRKED----------------- 243

  Fly   254 YMTTTCTRKAREDNRLTVMMVTIFLCFLVCFLPLMLANVVD-----DERNTSYPWLHII------ 307
                      ::..||..::.|:.:.|..|:.|..:...:|     |....|..:||.:      
Zfish   244 ----------QKKRRLLKIITTLVVVFAFCWTPFHVLKSMDALSYLDLAPNSCGFLHFLLLAHPY 298

  Fly   308 ASVMAWASSVINPIIYAASNRNYSESIFY---FRVAYYKIFALLKFWGEPLSPMPSRNYHQSKNS 369
            |:.:|:|:|.:||.:||          |:   ||.....:..|.|.....:|.|.|....|::.|
Zfish   299 ATCLAYANSCLNPFLYA----------FFDLRFRSQCLCLLNLKKAMHGHMSSMSSTLSAQTQKS 353

  Fly   370 K 370
            :
Zfish   354 E 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 72/296 (24%)
aplnraNP_001068573.1 7tm_1 49..314 CDD:278431 72/296 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.