| Sequence 1: | NP_001284901.1 | Gene: | Tre1 / 140439 | FlyBaseID: | FBgn0046687 | Length: | 399 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005949.1 | Gene: | MTNR1A / 4543 | HGNCID: | 7463 | Length: | 350 | Species: | Homo sapiens |
| Alignment Length: | 34 | Identity: | 10/34 - (29%) |
|---|---|---|---|
| Similarity: | 16/34 - (47%) | Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 40 GSYRHVMAVFALFSLVYTWIEFIAQPVMHIKQSM 73 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tre1 | NP_001284901.1 | 7tmA_GPR84-like | 37..341 | CDD:320338 | 10/34 (29%) |
| TM helix 1 | 37..63 | CDD:320338 | 8/22 (36%) | ||
| TM helix 2 | 71..94 | CDD:320338 | 2/3 (67%) | ||
| TM helix 3 | 109..139 | CDD:320338 | |||
| TM helix 4 | 153..171 | CDD:320338 | |||
| TM helix 5 | 195..220 | CDD:320338 | |||
| TM helix 6 | 264..294 | CDD:320338 | |||
| TM helix 7 | 302..327 | CDD:320338 | |||
| MTNR1A | NP_005949.1 | 7tm_GPCRs | 28..306 | CDD:475119 | |
| TM helix 1 | 30..54 | CDD:410628 | |||
| TM helix 2 | 63..85 | CDD:410628 | |||
| TM helix 3 | 101..123 | CDD:410628 | |||
| TM helix 4 | 146..162 | CDD:410628 | |||
| TM helix 5 | 185..208 | CDD:410628 | |||
| TM helix 6 | 237..259 | CDD:410628 | |||
| TM helix 7 | 274..299 | CDD:410628 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||