DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and MTNR1A

DIOPT Version :10

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_005949.1 Gene:MTNR1A / 4543 HGNCID:7463 Length:350 Species:Homo sapiens


Alignment Length:34 Identity:10/34 - (29%)
Similarity:16/34 - (47%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GSYRHVMAVFALFSLVYTWIEFIAQPVMHIKQSM 73
            |:.|....|.|.||::..|.:|........:||:
Human   778 GNVRRTPPVNAKFSIMPAWQKFSDSGAETFRQSL 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tmA_GPR84-like 37..341 CDD:320338 10/34 (29%)
TM helix 1 37..63 CDD:320338 8/22 (36%)
TM helix 2 71..94 CDD:320338 2/3 (67%)
TM helix 3 109..139 CDD:320338
TM helix 4 153..171 CDD:320338
TM helix 5 195..220 CDD:320338
TM helix 6 264..294 CDD:320338
TM helix 7 302..327 CDD:320338
MTNR1ANP_005949.1 7tm_GPCRs 28..306 CDD:475119
TM helix 1 30..54 CDD:410628
TM helix 2 63..85 CDD:410628
TM helix 3 101..123 CDD:410628
TM helix 4 146..162 CDD:410628
TM helix 5 185..208 CDD:410628
TM helix 6 237..259 CDD:410628
TM helix 7 274..299 CDD:410628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.