DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and Gpr25

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001094986.1 Gene:Gpr25 / 383563 MGIID:2686146 Length:358 Species:Mus musculus


Alignment Length:315 Identity:64/315 - (20%)
Similarity:119/315 - (37%) Gaps:54/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PHSATLFAAISACVFVTIGVLGN--LITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLT 93
            |:...:..|:....| .:|:.||  ::.||:..:.|   ......||:.|:.:||.|. .:|||.
Mouse    36 PYGHAIIPALYLAAF-AVGLPGNAFVVWLLSRQRGP---RRLVDTFVLHLAAADLGFV-LTLPLW 95

  Fly    94 AVRFFQES-WTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQL 157
            |....:.. |.||..|||:.............|.:.|::::||:.:........:...:.:....
Mouse    96 AAAEARGGLWPFGDGLCKVSSFALAVTRCAGALLLAGMSVDRYLAVGRPLSARPLRSARCVRAVC 160

  Fly   158 LFVWAVSFLLLLPPILGIWGEMGLDEATFSCTILKKEG-RSIKKTLFVIGFLLPCLVIIVSYSCI 221
            ...||.:||..||.:|....:..||.....|.....|. :.:...|.::.|.||..|.::.|..:
Mouse   161 GAAWAAAFLAGLPALLYRGLQPSLDGVGSQCAEEPWEALQGVGLLLLLLTFALPLAVTLICYWRV 225

  Fly   222 YITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTIFLCFLVCFLP 286
                                              :....|..|..:....::.|:...|:.|:||
Mouse   226 ----------------------------------SRRLPRVGRARSNSLRIIFTVESVFVGCWLP 256

  Fly   287 L-MLANVVDDERNTSYP----------WLHIIASVMAWASSVINPIIYAASNRNY 330
            . :|.::....|..:.|          |...:.:.:|:.:|..||:||...:|::
Mouse   257 FGVLRSLFHLARLQALPLPCSLLLALRWGLTVTTCLAFVNSSANPVIYLLLDRSF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 57/285 (20%)
Gpr25NP_001094986.1 7tm_1 56..304 CDD:278431 57/285 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.