DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and mtnr1ba

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_571470.1 Gene:mtnr1ba / 30669 ZFINID:ZDB-GENE-990415-157 Length:355 Species:Danio rerio


Alignment Length:307 Identity:81/307 - (26%)
Similarity:139/307 - (45%) Gaps:39/307 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQESWTFGTTLCKIF 112
            :.||||::.::::|::..:| :|..|||:||:.:|||...:..||.........|..|...||:.
Zfish    45 VDVLGNVLVIISVLRNRKLR-NAGNAFVVSLAFADLLVVCYPYPLVLHAMLHAGWLPGEMECKVS 108

  Fly   113 PVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQLLFVWAVSFLLLLPPILGIWG 177
            ..:...:|..|:.::..|.:|||..|...:.|.:||......:.|..||.::.:.:||.:  ..|
Zfish   109 GFLMGASVIGSIFNITAIAINRYCFICQANTYEKIYGRAGTLVLLTLVWVLTAIAILPNL--SLG 171

  Fly   178 EMGLDEATFSCTILKKEGRSIKKTLFVIGFLLPCLVIIVSYSCIYITVLHQKKKIRNHDNFQIAA 242
            .:..|...:|||..:.........:..:.||||..|:...|..|::.||..::::          
Zfish   172 SLTYDPRVYSCTFSQTTSAGYTIAVVTVHFLLPIAVVTFCYLRIWVLVLRVRRRV---------- 226

  Fly   243 AKGSSSSGGGSYMTTTCTRKAR-EDNRLTVMMVTIFLCFLVCFLPLM---LANVVDDER-NTSYP 302
                         ||....:.| .:.|..:.|..:|:.|.||:.||.   ||..||..| ....|
Zfish   227 -------------TTDVRPRLRPSELRHFLTMFVVFVLFAVCWAPLNLIGLAVAVDPPRVGPLVP 278

  Fly   303 -WLHIIASVMAWASSVINPIIYAASNRNYSESIFYFRVAYYKIFALL 348
             ||.:::..||:.:|.:|.::|...|:|       ||..|.:|...|
Zfish   279 DWLFVMSYFMAYFNSCLNAVVYGLLNQN-------FRREYRRILLSL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 71/276 (26%)
mtnr1baNP_571470.1 7tm_4 40..>145 CDD:304433 30/100 (30%)
7tm_1 49..300 CDD:278431 71/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5631
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4532
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.