DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and mtnr1al

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001153381.1 Gene:mtnr1al / 30660 ZFINID:ZDB-GENE-990415-154 Length:318 Species:Danio rerio


Alignment Length:328 Identity:87/328 - (26%)
Similarity:154/328 - (46%) Gaps:42/328 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YPHSATLFAAISACVFVTIGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTA 94
            :|...||.:::.....| :.|||||:.::::.::..:|: |..|||:||:|:|||...:..||..
Zfish    24 FPWVVTLLSSVLITTIV-VDVLGNLLVIVSVFRNRKLRK-AGNAFVVSLAIADLLVAIYPYPLVL 86

  Fly    95 VRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHS-RYSQIYKPKFITLQLL 158
            ...|.:.|..|...|:|...:...:|..|:.::.||.:|||..| ||| :|.:::..|.....::
Zfish    87 TAIFHDRWIAGDIHCQISGFLMGLSVIGSIFNITGIAINRYCYI-CHSLKYDKLFSNKNTVCYVI 150

  Fly   159 FVWAVSFLLLLPPILGIW--GEMGLDEATFSCTILKKEGRSIKKTLFVIGFLLPCLVIIVSYSCI 221
            .|||::.|.::|.    |  ..:..|...||||..:.........:.|:.|::|..::...|..|
Zfish   151 LVWALTVLAIVPN----WFVESLQYDPRVFSCTFAQSVSSLYTIMVVVVHFIVPIGIVTYCYLRI 211

  Fly   222 YITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTIFLCFLVCFLP 286
            :|.|:..:::::.....:|..                      .|.|..:.|..:|:.|.||:.|
Zfish   212 WILVIQVRRRVKPDSRPKIKP----------------------HDFRNFLTMFVVFVLFAVCWAP 254

  Fly   287 LM---LANVVDDERNTSYP-WLHIIASVMAWASSVINPIIYAASNRNYSESIFYFRVAYYKIFAL 347
            |.   ||..:......|.| ||...:..||:.:|.:|.:||...|.|:.:.  |.|:    :.|:
Zfish   255 LNFIGLAVAIHPRLGQSIPEWLFTASYFMAYFNSCLNGVIYGVLNHNFRKE--YKRI----VLAI 313

  Fly   348 LKF 350
            .||
Zfish   314 FKF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 72/277 (26%)
mtnr1alNP_001153381.1 7tm_4 43..>211 CDD:304433 51/173 (29%)
7tm_1 45..295 CDD:278431 72/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5631
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321514at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.