DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and Agtr2

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_036626.1 Gene:Agtr2 / 24182 RGDID:2072 Length:363 Species:Rattus norvegicus


Alignment Length:339 Identity:70/339 - (20%)
Similarity:133/339 - (39%) Gaps:100/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VFVTIGVLGNL--ITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRF-FQESWTFG 105
            :|| ||...|:  ::|....|.|   :..::.::.:|:::|||..: :|||.|..: ::..|.||
  Rat    54 IFV-IGFAVNIVVVSLFCCQKGP---KKVSSIYIFNLAVADLLLLA-TLPLWATYYSYRYDWLFG 113

  Fly   106 TTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQLLFVWAVSFLLLLP 170
            ..:||:|......|:..|:..:..::::||..: .:...||...|...:..:..||.::.|..||
  Rat   114 PVMCKVFGSFLTLNMFASIFFITCMSVDRYQSV-IYPFLSQRRNPWQASYVVPLVWCMACLSSLP 177

  Fly   171 PI----------LGI--------------WGEMGLDEATFSCTILKKEGRSIKKTLFVIGFLLPC 211
            ..          ||:              |                ..|.::.|.  ::||::|.
  Rat   178 TFYFRDVRTIEYLGVNACIMAFPPEKYAQW----------------SAGIALMKN--ILGFIIPL 224

  Fly   212 LVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTI 276
            :.|...|..|      :|..::.:                 ||.....||     :::..|...:
  Rat   225 IFIATCYFGI------RKHLLKTN-----------------SYGKNRITR-----DQVLKMAAAV 261

  Fly   277 FLCFLVCFLPLMLANVVDDERNTSYPWLHII---------------ASVMAWASSVINPIIYA-A 325
            .|.|::|:||..:...:|     :..|:.||               |.::.:.:|.:||.:|. .
  Rat   262 VLAFIICWLPFHVLTFLD-----ALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFV 321

  Fly   326 SNRNYSESIFYFRV 339
            .||...:....|||
  Rat   322 GNRFQQKLRSVFRV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 60/312 (19%)
Agtr2NP_036626.1 7tm_1 62..318 CDD:278431 60/311 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.