DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and Agtr1a

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_112247.2 Gene:Agtr1a / 24180 RGDID:2070 Length:359 Species:Rattus norvegicus


Alignment Length:388 Identity:89/388 - (22%)
Similarity:166/388 - (42%) Gaps:102/388 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MQMDEPAAATQS-IYPHSATLFAAISACVFVTIGVLGNLITLLAL---LKSPTIREHATTAFVIS 77
            :|.|.|.|...| |:....||::.|    || :|:.||.:.::.:   :|..|:    .:.|:::
  Rat    14 IQDDCPKAGRHSYIFVMIPTLYSII----FV-VGIFGNSLVVIVIYFYMKLKTV----ASVFLLN 69

  Fly    78 LSISDLLFCSFSLPLTAVRFFQE-SWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACH 141
            |:::||.|. .:|||.||....| .|.||..||||.......|:..|:..:..::::||:.|. |
  Rat    70 LALADLCFL-LTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIV-H 132

  Fly   142 SRYSQIYKPKFIT-LQLLFVWAVSFLLLLPPIL--GIWGEMGLDEATFSCTILKKEGRS------ 197
            ...|::.:...:. :..:.:|.::.|..||.::  .::   .::....:......|.|:      
  Rat   133 PMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVY---FIENTNITVCAFHYESRNSTLPIG 194

  Fly   198 IKKTLFVIGFLLPCLVIIVSYSCIYITVLH----QKKKIRNHDNFQIAAAKGSSSSGGGSYMTTT 258
            :..|..::|||.|.|:|:.||:.|:..:..    ||.|.||.|.|:|                  
  Rat   195 LGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFRI------------------ 241

  Fly   259 CTRKAREDNRLTVMMVTIFLCF------LVCFLPLM----------LANVVDDERNTSYPWLHII 307
                        :|.:.:|..|      :..||.::          ::::||    |:.|    |
  Rat   242 ------------IMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCKISDIVD----TAMP----I 286

  Fly   308 ASVMAWASSVINPIIYAASNRNYSESIFYFRVAYYKIFALLKFWGEPLSPMPSRNYHQSKNSK 370
            ...:|:.::.:||:.|....:.:.:   ||       ..|||:     .| |....|.|.::|
  Rat   287 TICIAYFNNCLNPLFYGFLGKKFKK---YF-------LQLLKY-----IP-PKAKSHSSLSTK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 66/303 (22%)
Agtr1aNP_112247.2 7tmA_AT1R 29..313 CDD:320320 73/338 (22%)
TM helix 1 31..55 CDD:320320 8/28 (29%)
TM helix 2 64..85 CDD:320320 8/21 (38%)
TM helix 3 102..124 CDD:320320 4/21 (19%)
TM helix 4 147..163 CDD:320320 3/15 (20%)
TM helix 5 193..216 CDD:320320 8/22 (36%)
TM helix 6 239..261 CDD:320320 5/51 (10%)
TM helix 7 281..306 CDD:320320 8/32 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 337..359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.