DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and Aplnr

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_035914.1 Gene:Aplnr / 23796 MGIID:1346086 Length:377 Species:Mus musculus


Alignment Length:358 Identity:74/358 - (20%)
Similarity:143/358 - (39%) Gaps:84/358 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDQDMGMATGY-FQDADMQMDEPAAATQSIYPHSATLFAAISACVFVTIGVLGNLITLLALLKSP 64
            |:.|     || :..||.|.:    ...:.:..|..|..||...||: :|..||.:.|..:.::.
Mouse     1 MEDD-----GYNYYGADNQSE----CDYADWKPSGALIPAIYMLVFL-LGTTGNGLVLWTVFRTS 55

  Fly    65 TIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQE-SWTFGTTLCKIFPVIFYGNVAVSLLSMV 128
            ..:..:...|:.||:::||.|. .:|||.|...::| .|.|||..||:...:.:.|:..|:..:.
Mouse    56 REKRRSADIFIASLAVADLTFV-VTLPLWATYTYREFDWPFGTFSCKLSSYLIFVNMYASVFCLT 119

  Fly   129 GITLNRYILIACHSRYSQIYKPKFITLQLLFVWAVSFLLLLPPIL---------GIWGEMGLD-- 182
            |::.:||:.|......:::.......:....:|.::.||.:|.::         |...:..:|  
Mouse   120 GLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAVPVMVFRSTDASENGTKIQCYMDYS 184

  Fly   183 -EATFSCTILKKEGRSIKKTLFVIGFLLPCLVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGS 246
             .||.:.....:.|..:..|  .:||::|..:::..|..|..|:....:|.|             
Mouse   185 MVATSNSEWAWEVGLGVSST--AVGFVVPFTIMLTCYFFIAQTIAGHFRKER------------- 234

  Fly   247 SSSGGGSYMTTTCTRKAREDNRLTVMMVTIFLCFLVCFLPLMLANVVDDERNTSYPWLHIIASVM 311
                         ....|:..||..::|.:.:.|.:|::|..|...           |:::.|::
Mouse   235 -------------IEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKT-----------LYMLGSLL 275

  Fly   312 AW--------------------ASSVINPIIYA 324
            .|                    .:|.:||.:||
Mouse   276 HWPCDFDIFLMNVFPYCTCISYVNSCLNPFLYA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 58/303 (19%)
AplnrNP_035914.1 7tm_4 31..>164 CDD:304433 35/134 (26%)
7tm_1 43..307 CDD:278431 58/303 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.