DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and npr-25

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_505883.1 Gene:npr-25 / 179570 WormBaseID:WBGene00011381 Length:376 Species:Caenorhabditis elegans


Alignment Length:326 Identity:64/326 - (19%)
Similarity:122/326 - (37%) Gaps:67/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SAC-VFVTIG---VLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTAVRFFQES 101
            |.| ||.|:|   ||..:..:...|||.......|..::::|...||| .:.|:|.:.......:
 Worm    28 SICFVFGTLGNTAVLSYVFFITRSLKSSVTALGNTFIYIVALCAVDLL-VTVSIPFSLSYMILNN 91

  Fly   102 WTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKFITLQLLFVWAVSFL 166
            |.||..:|||..::...|...|...:..:..:||:.| ||....:|::.:. |:.:..:.|...|
 Worm    92 WVFGELVCKIHFMLELSNKMCSTFILTALAFDRYMAI-CHPEIKRIHEMRH-TIYITTILATLSL 154

  Fly   167 LLLPPILGIWGEMGLDEATFSC----TILKKEGRSIKKTLFVIG-----------------FLLP 210
            .|:.|::     :.....:|..    ...|.|...:.:.:.:.|                 ||||
 Worm   155 FLISPVV-----LSARVTSFKSGQYFVSAKNERHEVIRQMCIDGMALEWKVWVSAFLIFFAFLLP 214

  Fly   211 CLVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVT 275
            |.::...|:.|.:.:..|::                           |..:......|:|:..:.
 Worm   215 CTLLTYFYAKIVLRLRRQRR---------------------------TMLQSRIPLRRITIYTMA 252

  Fly   276 IFLCFLVCFLPLML-------ANVVDDERNTSYPWLHIIASVMAWASSVINPIIYAASNRNYSES 333
            ....:|.|.:|..|       :.|:..:.|.........:.::.:.|:..|.|.||..|..:.:.
 Worm   253 ATFFYLSCHIPFWLPQIYNIFSTVLGHKMNPKVMTFTYYSHLLPFISAAFNWIFYARLNSQFKKG 317

  Fly   334 I 334
            :
 Worm   318 L 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 53/298 (18%)
npr-25NP_505883.1 7tm_classA_rhodopsin-like 24..311 CDD:381740 63/317 (20%)
TM helix 1 24..48 CDD:381740 8/19 (42%)
TM helix 2 63..84 CDD:381740 6/21 (29%)
TM helix 3 100..122 CDD:381740 4/21 (19%)
TM helix 4 144..160 CDD:381740 3/15 (20%)
TM helix 5 200..223 CDD:381740 5/22 (23%)
TM helix 6 244..269 CDD:381740 6/24 (25%)
TM helix 7 286..311 CDD:381740 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.