DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and Mtnr1a

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_032665.1 Gene:Mtnr1a / 17773 MGIID:102967 Length:353 Species:Mus musculus


Alignment Length:326 Identity:79/326 - (24%)
Similarity:154/326 - (47%) Gaps:41/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PHSATLFAAISACVFVTI--GVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLT 93
            |..:.|.:.::..:..||  .:||||:.:|::.::..:| ::...||:||:::||:...:..||.
Mouse    24 PRPSWLASTLAFILIFTIVVDILGNLLVILSVYRNKKLR-NSGNIFVVSLAVADLVVAVYPYPLV 87

  Fly    94 AVRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHS-RYSQIYKPKFITLQL 157
            ........|..|...|::...:...:|..|:.::.||.:|||..| ||| :|.:||..|.....:
Mouse    88 LTSILNNGWNLGYLHCQVSAFLMGLSVIGSIFNITGIAMNRYCYI-CHSLKYDKIYSNKNSLCYV 151

  Fly   158 LFVWAVSFLLLLPPILGIWGEMGLDEATFSCTILKKEGRSIKKTLFVIGFLLPCLVIIVSYSCIY 222
            ..:|.::.:.::|.:.  .|.:..|...:|||..:....:....:.|..|::|.:::|..|..|:
Mouse   152 FLIWMLTLIAIMPNLQ--TGTLQYDPRIYSCTFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRIW 214

  Fly   223 ITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTIFLCFLVCFLPL 287
            :.||..:::::..:..::..                      :|.|..|.|..:|:.|.:|:.||
Mouse   215 VLVLQVRRRVKPDNKPKLKP----------------------QDFRNFVTMFVVFVLFAICWAPL 257

  Fly   288 -MLANVVDDERNTSYP----WLHIIASVMAWASSVINPIIYAASNRNYSESIFYFRVAYYKIFAL 347
             ::..:|..:..|..|    ||.:.:..:|:.:|.:|.|||...|:|       ||..|.||...
Mouse   258 NLIGLIVASDPATMVPRIPEWLFVASYYLAYFNSCLNAIIYGLLNQN-------FRKEYKKIIVS 315

  Fly   348 L 348
            |
Mouse   316 L 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 64/276 (23%)
Mtnr1aNP_032665.1 7tm_4 38..>160 CDD:304433 35/123 (28%)
7tm_1 47..298 CDD:278431 64/276 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5667
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6586
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.