DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and Gpr50

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_034470.1 Gene:Gpr50 / 14765 MGIID:1333877 Length:591 Species:Mus musculus


Alignment Length:327 Identity:87/327 - (26%)
Similarity:152/327 - (46%) Gaps:43/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YPHSATLFAAISACVFVTIGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPLTA 94
            ||.:..:|...:..:.|.:.::||.:.:||:.|:..:| ::...||.|||::|:|...:..||..
Mouse    31 YPPALIIFMFCAMVITVVVDLIGNSMVILAVTKNKKLR-NSGNIFVASLSVADMLVAIYPYPLML 94

  Fly    95 VRFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHS-RYSQIYKPKFITLQLL 158
            .......|......|::..::...:|..|:.::..|.:|||..| ||| :|.:|:..:...:.|:
Mouse    95 YAMSVGGWDLSQLQCQMVGLVTGLSVVGSIFNITAIAINRYCYI-CHSLQYKRIFSLRNTCIYLV 158

  Fly   159 FVWAVSFLLLLPPILGIWGEMGLDEATFSCTILKKEGRSIKKTLFVIGFLLPCLVIIVSYSCIYI 223
            ..|.::.|.:||.:  ..|.:..|..|::|........:...|:..|.|:||.:::...|:.|:|
Mouse   159 VTWVMTVLAVLPNM--YIGTIEYDPRTYTCIFNYVNNPAFTVTIVCIHFVLPLIIVGYCYTKIWI 221

  Fly   224 TVLHQKKKI-RNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTIFLCFLVCFLPL 287
            .||..:... :|.|| |.|..:                      |.||  |..|||.|.||:.|:
Mouse   222 KVLAARDPAGQNPDN-QFAEVR----------------------NFLT--MFVIFLLFAVCWCPV 261

  Fly   288 ----MLANVVDDERNTSYP-WLHIIASVMAWASSVINPIIYAASNRNYSESIFYFRVAYYKIFAL 347
                :|..|:..|.....| ||::.|..:|:.:|.:|.|||...|.:       ||..|:.||..
Mouse   262 NVLTVLVAVIPKEMAGKIPNWLYLAAYCIAYFNSCLNAIIYGILNES-------FRREYWTIFHA 319

  Fly   348 LK 349
            ::
Mouse   320 MR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 75/277 (27%)
Gpr50NP_034470.1 7tm_4 44..>189 CDD:304433 39/148 (26%)
7tm_1 53..302 CDD:278431 75/277 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5667
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.