DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and Bdkrb1

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_031565.1 Gene:Bdkrb1 / 12061 MGIID:88144 Length:334 Species:Mus musculus


Alignment Length:334 Identity:82/334 - (24%)
Similarity:135/334 - (40%) Gaps:86/334 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ISACVFVTIGVLGNLITLLALLKS-----PTIREHATTA--FVISLSISDLLFCSFSLPLTAV-- 95
            |:.|.|   |:||||:.|...|..     ...|:..|.|  ::.:|:.|||:|. ..||..|.  
Mouse    44 ITVCFF---GLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFV-LGLPFWAENV 104

  Fly    96 --RFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIAC--------HSRYSQIYKP 150
              ||   :|.||:.||::...:...|:.:|:..:|.|:.:||.|:..        ..|.:|:   
Mouse   105 GNRF---NWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQV--- 163

  Fly   151 KFITLQLLFVWAVSFLLLLPPILGIWGEMGLDEATFSCTILKKEG-----RSIKKTLFVIGFLLP 210
                 ..|.:|....||..|..|....::..|....:|.:|....     |.::  |.|:|||||
Mouse   164 -----TCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVE--LNVLGFLLP 221

  Fly   211 CLVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVT 275
            ...|:                   :.||.|.|    |..|......|.|  ...:|::...:::|
Mouse   222 LAAIL-------------------YFNFHILA----SLRGQKEASRTRC--GGPKDSKTMGLILT 261

  Fly   276 IFLCFLVCFLP---------LMLANVVDDERNTSYPWLHI------IASVMAWASSVINPIIYAA 325
            :...||||:.|         |:...|:.|     ..|..:      :|:..|:.:|.:||:||..
Mouse   262 LVASFLVCWAPYHFFAFLDFLVQVRVIQD-----CFWKELTDLGLQLANFFAFVNSCLNPLIYVF 321

  Fly   326 SNRNYSESI 334
            :.|.:...:
Mouse   322 AGRLFKTRV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 74/309 (24%)
Bdkrb1NP_031565.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
7tm_1 77..319 CDD:278431 68/285 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.