DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tre1 and agtr1b

DIOPT Version :9

Sequence 1:NP_001284901.1 Gene:Tre1 / 140439 FlyBaseID:FBgn0046687 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_005162585.1 Gene:agtr1b / 100333455 ZFINID:ZDB-GENE-110411-117 Length:359 Species:Danio rerio


Alignment Length:377 Identity:88/377 - (23%)
Similarity:149/377 - (39%) Gaps:89/377 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TLFAAISACVFVTIGVLGNLITLLALLKSPTIREHATTAFVISLSISDLLFCSFSLPL----TAV 95
            |....:..|.|| ||::||.:.:..:.:...::..| ..||::|:||||.|. .:|||    ||.
Zfish    27 TFIPVVYGCNFV-IGIIGNSMVVAVIFRYMKLKTVA-NVFVLNLAISDLTFL-ITLPLWATFTAT 88

  Fly    96 RFFQESWTFGTTLCKIFPVIFYGNVAVSLLSMVGITLNRYILIACHSRYSQIYKPKF-ITLQLLF 159
            .:   .|.||..|||....:...|:..|:..:..::::||:.|. |...|:..:..| ..|..:.
Zfish    89 GY---HWIFGAFLCKASAGMVIFNLYTSIFFLTALSIDRYLAIV-HPVRSRRQRTLFYANLTCVL 149

  Fly   160 VWAVSFLLLLPPIL-------------GIWGEMGLDEATFSCTILKKEGRSIKKTLFVIGFLLPC 211
            :|..:.||..|..|             .:|..........:.::||.          |:||::|.
Zfish   150 IWLFALLLSAPTALSRDVYDIGNLTLCAVWHSSKQIHFLVTLSVLKS----------VLGFIVPF 204

  Fly   212 LVIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTCTRKAREDNRLTVMMVTI 276
            |:|...|..|...:|..:..:|.                         :.::|||..|.::..|:
Zfish   205 LIIFTCYCLIGRALLGSRGLLRK-------------------------SVRSREDETLRMIAATV 244

  Fly   277 FLCFLVCFLP---------LMLANVVD-----DERNTSYPWLHIIASVMAWASSVINPIIYAASN 327
             |.|.||:.|         |....||:     |..:|:.|:...|    ::.:|.:|||:|....
Zfish   245 -LAFFVCWAPHQAFHFMELLATLGVVENCQTLDVIDTAMPFTICI----SYLNSCVNPILYGFVG 304

  Fly   328 RNYSESIFYFRVAYYKIFALLKFWGEPLSPMPSRNYHQSKNSKELSGVIRST 379
            .|:.::          :..||.......|...|.|.....||...||::..|
Zfish   305 HNFRKN----------LLRLLSCGSGEASNRFSINSKIDVNSHCNSGLLNQT 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tre1NP_001284901.1 7tm_1 52..323 CDD:278431 70/302 (23%)
agtr1bXP_005162585.1 7tm_4 38..>158 CDD:304433 36/126 (29%)
7tm_1 43..300 CDD:278431 70/302 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.