DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Evx1 and CG34031

DIOPT Version :10

Sequence 1:NP_031992.1 Gene:Evx1 / 14028 MGIID:95461 Length:416 Species:Mus musculus
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:69 Identity:30/69 - (43%)
Similarity:43/69 - (62%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse   184 RRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQ---RLAM 245
            |:.|.|::..|:.|||.||..:.|:|..:|.||:.:|:|.|..:|.||||||.|.|:|   ||.:
  Fly   134 RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKI 198

Mouse   246 TWPH 249
            ...|
  Fly   199 AHRH 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Evx1NP_031992.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..178
Homeodomain 184..240 CDD:459649 25/55 (45%)
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.