DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bcl11a and CG4360

DIOPT Version :9

Sequence 1:NP_001229863.1 Gene:Bcl11a / 14025 MGIID:106190 Length:835 Species:Mus musculus
Sequence 2:NP_650879.1 Gene:CG4360 / 42413 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster


Alignment Length:557 Identity:119/557 - (21%)
Similarity:191/557 - (34%) Gaps:164/557 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse   340 QRLLQPFQP-------------------GSKPPFLATPPLPPLQSAPPPSQ----PPVKSKSCEF 381
            |.:|.|..|                   ||..|.  :|....:||.....:    .|.|.|.|..
  Fly    84 QAMLHPQHPLVHLLDISTTTANSGGGGGGSHTPI--SPMKQEVQSVISEEEVVVDDPRKKKQCHV 146

Mouse   382 CGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKLKRHMKTHMHKSSPMTVKSDDGLSTAS 446
            |...|:..:.|..|.:.||.|:||||..||.|..|.|.|..|:|.|                  :
  Fly   147 CKNKFRQLTTLRNHMKIHTDERPYKCKHCDKAFRQISTLTNHVKIH------------------T 193

Mouse   447 SPEPGTSDLVGSASSALKSVVAKFKS-----ENDP----NLIPENGDEEEEEDDEEEEEEEEEEE 502
            ..:|.|.::.........:::...|:     .:.|    |..|:.|..:..:....:..:::.:.
  Fly   194 GEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNYQPQTGSGKHRKSQMHQAYQQQHQR 258

Mouse   503 EELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDEGRALPDVMQGMVLSSMQHFSEAFHQVLG 567
            .:::::.   |....|..||.......:.:|.     .|..|.      ||::.:          
  Fly   259 VQISKTL---YSGSYSSPAAEELVKPFQCSVC-----KRRFPQ------LSTLHN---------- 299

Mouse   568 EKHKRSHLAEAEGHRDTCDE-------------------------------------DSVAGESD 595
              |:|:|:.......:|||:                                     :.:...:.
  Fly   300 --HERTHIDPKPYKCETCDKSFSQLATLANHKKIHTGDKPYTCSYCHMQFRQQSTLTNHLKTHTH 362

Mouse   596 RIDDGTVNGRGCSPGESASGGLSKKLLLGSPSSLSPFSKRIKLEKEFDLPPAAMPNTENVYSQWL 660
            :|..|.|.|.|     ...|.::..:....|:.|:|.:::        |....:||.       |
  Fly   363 QIAPGGVGGAG-----GGGGAVTATVDHSMPAPLAPGTQQ--------LTSGLLPNN-------L 407

Mouse   661 AGYAASRQLKD--PFLTFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGISGRSGTGSG---- 719
            .|..|:....|  |.|.|.|       .|:..||...:...:|.......|     |:.||    
  Fly   408 HGSTANIIQLDHHPLLHFLD-------GSTTVSSVVATAAANTKVEHFQAG-----GSPSGRMTV 460

Mouse   720 -GSTPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSS 783
             |:...:.|..|.||..        |..|.:.|...|.|..|.::||||:||||::|.....|.:
  Fly   461 VGTINMLKGDNPDRPFG--------CSVCQRFFSQQSTLVNHIKTHTGEKPYKCKICEVNFRQVA 517

Mouse   784 KLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMK 820
            .|..|||.|  .|:..|.|..|...|...|||:.|::
  Fly   518 TLNNHMKIH--TGEKPYNCSFCPKQFRQKSTLQNHLR 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bcl11aNP_001229863.1 Required for nuclear body formation and for SUMO1 recruitment 1..210
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..376 11/58 (19%)
zf-C2H2 378..399 CDD:395048 5/20 (25%)
C2H2 Zn finger 379..399 CDD:275368 5/19 (26%)
zf-H2C2_2 391..416 CDD:404364 12/24 (50%)
C2H2 Zn finger 407..427 CDD:275368 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..458 5/36 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 471..512 5/49 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 572..619 11/83 (13%)
zf-C2H2 743..764 CDD:395048 6/20 (30%)
C2H2 Zn finger 744..764 CDD:275368 6/19 (32%)
zf-H2C2_2 756..781 CDD:404364 11/24 (46%)
C2H2 Zn finger 772..792 CDD:275368 7/19 (37%)
C2H2 Zn finger 802..820 CDD:275368 7/17 (41%)
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
zf-H2C2_2 157..181 CDD:290200 12/23 (52%)
C2H2 Zn finger 172..192 CDD:275368 9/19 (47%)
zf-H2C2_2 185..209 CDD:290200 6/41 (15%)
C2H2 Zn finger 200..220 CDD:275368 1/19 (5%)
C2H2 Zn finger 284..304 CDD:275368 7/42 (17%)
zf-C2H2_8 287..363 CDD:292531 10/98 (10%)
C2H2 Zn finger 312..332 CDD:275368 3/19 (16%)
C2H2 Zn finger 340..360 CDD:275368 0/19 (0%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-H2C2_2 491..515 CDD:290200 11/23 (48%)
C2H2 Zn finger 506..526 CDD:275368 7/19 (37%)
zf-H2C2_2 519..543 CDD:290200 10/25 (40%)
C2H2 Zn finger 534..554 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.