DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Etv1 and Ets65A

DIOPT Version :9

Sequence 1:XP_006515027.1 Gene:Etv1 / 14009 MGIID:99254 Length:493 Species:Mus musculus
Sequence 2:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster


Alignment Length:158 Identity:68/158 - (43%)
Similarity:91/158 - (57%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse   334 QEPGMYRE-GPTYQR-----RGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWG 392
            ::|..|:. |||..|     .|.:||||||:.||.|.:|:..|.|.|...||||.:|:|||||||
  Fly   294 RQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWG 358

Mouse   393 IQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERH 457
            .:|::|.||||||||:|||||:|.||.||.|:||.|||  |.:.|.:...|....|..|...:..
  Fly   359 ERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFQGLAAATQPAASDPTYKYQSDLF 421

Mouse   458 INEEDTVPLSHFDESMTYMPEGGCCNPH 485
            :     .|..|..:..::|      :||
  Fly   422 M-----TPYHHSAKLSSFM------SPH 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Etv1XP_006515027.1 ETS_PEA3_N 31..349 CDD:368026 6/20 (30%)
ETS 350..434 CDD:197710 51/83 (61%)
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 52/86 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.