DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Etv2 and Ets96B

DIOPT Version :9

Sequence 1:XP_006539604.1 Gene:Etv2 / 14008 MGIID:99253 Length:358 Species:Mus musculus
Sequence 2:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster


Alignment Length:195 Identity:71/195 - (36%)
Similarity:95/195 - (48%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse   191 AHEDYKMSWGGSAGSDYTTTWNTGLQDCSIPFE-GHQSPAF--TTPS-------KSNKQSD-RAT 244
            ||:....|  .|...|.:.|....:.|..:.:: |..:.|.  |.||       .|...|| ...
  Fly   410 AHQQQTQS--QSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTSSDAELR 472

Mouse   245 LTRYSKTN-------------HRGPIQLWQFLLELLHDGARS-SCIRWTGNSREFQLCDPKEVAR 295
            |.::..:|             .||.:||||||:.||.:...| |||.|||...||:|.:|:||||
  Fly   473 LDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVAR 537

Mouse   296 LWGERKRKPGMNYEKLSRGLRYYYRRDIVLKSGGRKYTYRFGGRV--PVLAYQDDMGHLPGAEGQ 358
            .||.:|.:|.|||:||||.|||||.:.|:.|..|.:|.|||   |  |...:....|||....|:
  Fly   538 RWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRF---VCDPDALFNMAYGHLTTGSGK 599

Mouse   359  358
              Fly   600  599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Etv2XP_006539604.1 ETS 256..338 CDD:197710 46/82 (56%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 47/88 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.