DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Etv2 and pnt

DIOPT Version :9

Sequence 1:XP_006539604.1 Gene:Etv2 / 14008 MGIID:99253 Length:358 Species:Mus musculus
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:284 Identity:101/284 - (35%)
Similarity:129/284 - (45%) Gaps:74/284 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse   131 PGTSPSPFVGF-EGATGQNPAT--SAGGVPSWSHPPAAWSTTSWDCSVGPSGATYWDNGLGGEA- 191
            |||......|: .|:..||..|  |:.|:|:..   ||:...|   ..||:|..  .:|.||:. 
  Fly   431 PGTQNGNIGGYGGGSNSQNDPTDLSSYGLPAHL---AAYGGGS---GSGPTGGR--SSGGGGDES 487

Mouse   192 ----------HEDYKMSWG-GSAGSDYTTTWNT-GLQDCSIPFEGHQS----------PAFTTPS 234
                      |:..:.|.| ||.|:...:|.|: |..|.|..|.|..:          |.||...
  Fly   488 DYHSTISAQDHQSQQSSGGNGSGGASGGSTGNSNGYLDSSSEFYGSYAGRNRFHDGYPPEFTPYD 552

Mouse   235 KSNKQS-----------------------------DRATLTRYSKT------NHRGPIQLWQFLL 264
            ..:.||                             |:..|..|:..      ...||||||||||
  Fly   553 AQSFQSMGPQPTAMDQWGAAHAHQHPAAYMSTLGLDKGLLGGYTTQGGVPCFTGSGPIQLWQFLL 617

Mouse   265 ELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDIVLKSGG 329
            |||.|....|.|.|||:..||:|.||.||||.||.||.||.||||||||||||||.::|:.|:.|
  Fly   618 ELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTAG 682

Mouse   330 RKYTYRFGGRVPVLAYQDDMGHLP 353
            ::|.|||     |...|:.:||.|
  Fly   683 KRYVYRF-----VCDLQNLVGHTP 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Etv2XP_006539604.1 ETS 256..338 CDD:197710 54/81 (67%)
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 55/88 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.