DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRKL and crkl

DIOPT Version :9

Sequence 1:NP_005198.1 Gene:CRKL / 1399 HGNCID:2363 Length:303 Species:Homo sapiens
Sequence 2:NP_989060.1 Gene:crkl / 394657 XenbaseID:XB-GENE-976114 Length:289 Species:Xenopus tropicalis


Alignment Length:268 Identity:206/268 - (76%)
Similarity:226/268 - (84%) Gaps:15/268 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINS 65
            ||||||||||||.||.|||||||||:||||||||:||||||||||||:|||||||||||||||||
 Frog     1 MSSARFDSSDRSGWYFGPVSRQEAQSRLQGQRHGVFLVRDSSTCPGDHVLSVSENSRVSHYIINS 65

Human    66 LPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRT 130
            ||.||:||||||||:|||||:|||||||||||||||||||||||:|:.:||::|..|:|||||||
 Frog    66 LPGRRYKIGDQEFDNLPALLDFYKIHYLDTTTLIEPAPRYPSPPVGTGTAPSVPVPEENLEYVRT 130

Human   131 LYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNS 195
            ||||||||||||||||||||||:||||||||||||||||:|||||||||||.|.|.|||.|||||
 Frog   131 LYDFPGNDAEDLPFKKGEILVIVEKPEEQWWSARNKDGRIGMIPVPYVEKLSRLSLHGKMGNRNS 195

Human   196 NSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEV 260
            |||||||||||||||||.:|||| |.:|.|.|.           .||....| ..:...|:.:.|
 Frog   196 NSYGIPEPAHAYAQPQTPSPLPA-SSTPPAVIQ-----------FKAGSGAV-SGHGSAAIIVLV 247

Human   261 GD--IVKV 266
            ||  |:||
 Frog   248 GDGQILKV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRKLNP_005198.1 SH2_CRK_like 6..106 CDD:198180 90/99 (91%)
SH3_CRK_N 126..180 CDD:212692 51/53 (96%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..234 34/49 (69%)
SH3_CRK_C 237..293 CDD:212693 10/32 (31%)
crklNP_989060.1 SH2_CRK_like 6..106 CDD:198180 90/99 (91%)
SH3_CRK_N 126..180 CDD:212692 51/53 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I21986
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38021
Inparanoid 1 1.050 557 1.000 Inparanoid score I6966
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52661
OrthoDB 1 1.010 - - D1414461at2759
OrthoFinder 1 1.000 - - FOG0003539
OrthoInspector 1 1.000 - - oto156651
Panther 1 1.100 - - LDO PTHR19969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.