DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMXL3 and NSR1

DIOPT Version :9

Sequence 1:NP_001138818.1 Gene:RBMXL3 / 139804 HGNCID:26859 Length:1067 Species:Homo sapiens
Sequence 2:NP_011675.1 Gene:NSR1 / 853064 SGDID:S000003391 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:288 Identity:70/288 - (24%)
Similarity:114/288 - (39%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     3 EADRPEKLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAAR 67
            |.:.|..:|:|.|:...|::.||.||...|.:|...::.:|.|::|||:.:|.||:.:.|:.|.:
Yeast   163 ETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQ 227

Human    68 DMNGKYLDGKAIMV-AQTIKPAFKSSR--WVPPTPGSGSRSRF------------------SHRT 111
            :|.||.:||:.|.. ..|.|||..:.|  ....||...|.:.|                  .|..
Yeast   228 EMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGE 292

Human   112 RGGGSSPQRPPSQGRPDDGRGYAGYFDLWPYRAPMPRKRG------PPPRHWASPPHKRATPSSL 170
            ......|..|.:: :| .|.||..:.::...:..:...:|      |....::||     .|:: 
Yeast   293 VVSVRIPTHPETE-QP-KGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSP-----RPNN- 349

Human   171 AHSVGCGMRGKAPTVSGQDGYSGLQPRRWAGPPHKRAVPRSSLARIGGSGMPGKAPAVWGQDGY- 234
                 .|.||      |..|:.|    |..|             |.|..|..|:..|..|:.|: 
Yeast   350 -----DGGRG------GSRGFGG----RGGG-------------RGGNRGFGGRGGARGGRGGFR 386

Human   235 ---SGPRVREPLPPCRDPGDFVPALRDY 259
               ||... .||...|:...|..:.:.:
Yeast   387 PSGSGANT-APLGRSRNTASFAGSKKTF 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMXL3NP_001138818.1 RRM <1..>81 CDD:223796 28/77 (36%)
RRM_RBMX_like 7..86 CDD:240828 28/79 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 9/60 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..175 5/36 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..1067
NSR1NP_011675.1 RRM1_gar2 169..244 CDD:409881 26/74 (35%)
RRM2_gar2 269..341 CDD:409882 10/73 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I2660
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.