DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMXL3 and MGC147226

DIOPT Version :9

Sequence 1:NP_001138818.1 Gene:RBMXL3 / 139804 HGNCID:26859 Length:1067 Species:Homo sapiens
Sequence 2:XP_012816817.1 Gene:MGC147226 / 780086 XenbaseID:XB-GENE-5822220 Length:521 Species:Xenopus tropicalis


Alignment Length:87 Identity:20/87 - (22%)
Similarity:30/87 - (34%) Gaps:11/87 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   331 EYQGNSPDACSEGRSSEALPVVLPDAYSRDHSPKAYSGGRSSSSNGYSRSDRYGEEGCYEEYRGR 395
            ||.....|.||...|.:..|..|........:..|    :..:|:|.::.|      |.....|.
 Frog     6 EYLEKITDLCSSSSSGDEFPQELRTCLETASNIVA----KLRASSGLAKKD------CAGAVCGN 60

Human   396 -SPDAHSGGRNSSSNSYGQSHH 416
             |..|...|:.:..|:|....|
 Frog    61 TSKQAAQSGQCTGINAYKMLAH 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMXL3NP_001138818.1 RRM <1..>81 CDD:223796
RRM_RBMX_like 7..86 CDD:240828
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..1067 12/61 (20%)
MGC147226XP_012816817.1 AdoMet_MTases 78..241 CDD:388410 1/5 (20%)
NADB_Rossmann 269..518 CDD:389744
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003420
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.