Sequence 1: | NP_001138818.1 | Gene: | RBMXL3 / 139804 | HGNCID: | 26859 | Length: | 1067 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006916.1 | Gene: | rbm38 / 448763 | XenbaseID: | XB-GENE-489545 | Length: | 219 | Species: | Xenopus tropicalis |
Alignment Length: | 236 | Identity: | 55/236 - (23%) |
---|---|---|---|
Similarity: | 82/236 - (34%) | Gaps: | 76/236 - (32%) |
- Green bases have known domain annotations that are detailed below.
Human 9 KLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNGKY 73
Human 74 LDGKAIMV-------------------AQTIKPAFKSSRW-----------------VPPTP--- 99
Human 100 -------GSGSRSRFSHRTRGGGSSPQRPPSQGRPDDGRGYAGYFDLWPYRAPMPRKRGPPPRHW 157
Human 158 ASPPHKRATPSSLAHSVGCGMRGKAPTVSGQDGYSGLQPRR 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RBMXL3 | NP_001138818.1 | RRM | <1..>81 | CDD:223796 | 27/71 (38%) |
RRM_RBMX_like | 7..86 | CDD:240828 | 29/95 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 90..131 | 9/67 (13%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..175 | 2/30 (7%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 267..305 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 357..1067 | ||||
rbm38 | NP_001006916.1 | RRM_RBM24_RBM38_like | 11..86 | CDD:240830 | 28/74 (38%) |
RRM | <23..187 | CDD:330708 | 40/193 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
NCBI | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |