DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMXL3 and rbm38

DIOPT Version :9

Sequence 1:NP_001138818.1 Gene:RBMXL3 / 139804 HGNCID:26859 Length:1067 Species:Homo sapiens
Sequence 2:NP_001006916.1 Gene:rbm38 / 448763 XenbaseID:XB-GENE-489545 Length:219 Species:Xenopus tropicalis


Alignment Length:236 Identity:55/236 - (23%)
Similarity:82/236 - (34%) Gaps:76/236 - (32%)


- Green bases have known domain annotations that are detailed below.


Human     9 KLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNGKY 73
            |:|:|||...|.:.:|:..|..:|.|.:..::.||:|.||||:.|||....|.|:.|.:|.| ..
 Frog    12 KIFVGGLPYHTTDASLRKYFEVFGDIDEAVVITDRQTGKSRGYGFVTMSDRAAAERACKDPN-PI 75

Human    74 LDGKAIMV-------------------AQTIKPAFKSSRW-----------------VPPTP--- 99
            :||:...|                   .|.:.|||....:                 |.|||   
 Frog    76 IDGRKANVNLAYLGAKPRNLQSAFTIGVQQLHPAFIQRPFGLTPQYIYPPAIVQPSVVIPTPIPS 140

Human   100 -------GSGSRSRFSHRTRGGGSSPQRPPSQGRPDDGRGYAGYFDLWPYRAPMPRKRGPPPRHW 157
                   .:.:...|:|.|.   ::.::.|....|  ..||.||                     
 Frog   141 LQSPYIDYNAATQAFTHYTT---AAYEQYPYAASP--ATGYMGY--------------------- 179

Human   158 ASPPHKRATPSSLAHSVGCGMRGKAPTVSGQDGYSGLQPRR 198
               .:..|....|:.:......|..||...|.....|||.|
 Frog   180 ---GYTSAVQQPLSATTTTATTGAPPTAYIQYQPQQLQPDR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMXL3NP_001138818.1 RRM <1..>81 CDD:223796 27/71 (38%)
RRM_RBMX_like 7..86 CDD:240828 29/95 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 9/67 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..175 2/30 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..1067
rbm38NP_001006916.1 RRM_RBM24_RBM38_like 11..86 CDD:240830 28/74 (38%)
RRM <23..187 CDD:330708 40/193 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.