DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMXL3 and CG3335

DIOPT Version :9

Sequence 1:NP_001138818.1 Gene:RBMXL3 / 139804 HGNCID:26859 Length:1067 Species:Homo sapiens
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:239 Identity:54/239 - (22%)
Similarity:93/239 - (38%) Gaps:49/239 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     5 DRPE---KLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDR-----KTNKSRGFAFVTFESPAD 61
            |.||   .||:..||.||.::.::..|...|.|..|.:.|.|     :..||.|:.|:.|:..:.
  Fly   673 DEPEPNTTLFLRNLNFKTVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGYGFIQFKKSSV 737

Human    62 AKAAARDMNGKYLDGKAIMVAQTIKPAFKSSRWVPPTPGSGSRSRFSHRTRGGGSS--PQRPPSQ 124
            |:.|.:::...::||..:.:.       :|.|.:......|::.|.:.:.:..|:.  .:..|.|
  Fly   738 AEHALKNLQLTHIDGNPVELK-------RSDRVLKTQDNDGAQRRLASQKKQTGTKILVRNIPFQ 795

Human   125 GRPDDGRG-YAGYFDLWPYRAPMPRKRGPPPRHWASPPHKRATPSSLAHSVGCGM---RGKAPTV 185
            .:..:.|. :..:.:|...|.|                 |:||....||. |.|.   ..||...
  Fly   796 AQYREVRDIFKAFGELRSLRIP-----------------KKATTGEDAHR-GFGFVDYMSKAEAK 842

Human   186 SGQDGYSG---LQPRR----WAGPPHKRAVP---RSSLARIGGS 219
            ...|..|.   |..||    |:.....:.|.   :.:.|:..||
  Fly   843 RAFDALSASTHLYGRRLVLEWSANDDNQDVEELRKRTAAKFDGS 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMXL3NP_001138818.1 RRM <1..>81 CDD:223796 24/83 (29%)
RRM_RBMX_like 7..86 CDD:240828 23/86 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 7/42 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..175 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..1067
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 44/196 (22%)
RRM5_RBM19_like 679..760 CDD:240764 21/87 (24%)
RRM6_RBM19 785..864 CDD:241015 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.