DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMXL3 and bol

DIOPT Version :9

Sequence 1:NP_001138818.1 Gene:RBMXL3 / 139804 HGNCID:26859 Length:1067 Species:Homo sapiens
Sequence 2:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster


Alignment Length:233 Identity:53/233 - (22%)
Similarity:82/233 - (35%) Gaps:61/233 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     7 PEKLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNG 71
            |.::|:||::..|.|..|...|..||.:....::.|| ...|:|:.|||||:..:|:..      
  Fly    32 PNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRL------ 89

Human    72 KYLDGKAIMVAQ---TIKPAFKSS----------------RWVPPTPGSG-SRSRFSHRT----- 111
             ..||:.:::..   .|.||.|..                ...||.|.|. ...:|:...     
  Fly    90 -QADGECVVLRDRKLNIAPAIKK
QPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPVT 153

Human   112 --RGGGSSPQRPPSQGRPDDGRGYAGYFDLWPYRAPMPRKRGPPPRHWASPPHKRATPSSLAHSV 174
              ...|.....|||      ...|..::..  |..||     ..|..|  |.:.:...|.|.|| 
  Fly   154 DFTAAGVPAIYPPS------AMQYQPFYQY--YSVPM-----NVPTIW--PQNYQENHSPLLHS- 202

Human   175 GCGMRGKAPTVSGQDGYSGLQPRR--WAGPPHKRAVPR 210
                    ||.:....:|...|:.  |:....:..:||
  Fly   203 --------PTSNPHSPHSQSHPQSPCWSIEDLRDTLPR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMXL3NP_001138818.1 RRM <1..>81 CDD:223796 22/73 (30%)
RRM_RBMX_like 7..86 CDD:240828 22/81 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 10/64 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..175 9/30 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..1067
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 25/86 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.