DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RBMXL3 and rbm-42

DIOPT Version :9

Sequence 1:	NP_001138818.1	Gene:	RBMXL3 / 139804	HGNCID:	26859	Length:	1067	Species:	Homo sapiens
Sequence 2:	NP_498090.1	Gene:	rbm-42 / 175700	WormBaseID:	WBGene00021901	Length:	302	Species:	Caenorhabditis elegans

Alignment Length:	86	Identity:	26/86 - (30%)
Similarity:	45/86 - (52%)	Gaps:	8/86 - (9%)

- Green bases have known domain annotations that are detailed below.

Human     9 KLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNGKY 73
            ::|.|.|..:..::.|...|.||....|..::::.:||||:|:.||:|....|...|.|:|:|||
Worm   204 RVFCGDLGNEVSDELLAKAFRKYPSFQKAKVVRESRTNKSKGYGFVSFRDSEDYVRAMREMDGKY 268

Human    74 LDGKAIMVAQTIKPAFKSSRW 94
            :..:.|.:        :.|.|
Worm   269 VGNRPIKL--------RKSAW 281

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RBMXL3	NP_001138818.1	RRM	<1..>81	CDD:223796	24/71 (34%)
		RRM_RBMX_like	7..86	CDD:240828	24/76 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	90..131		2/5 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	144..175
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	267..305
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	357..1067
rbm-42	NP_498090.1	RRM_RBM42	197..279	CDD:240829	24/82 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0226
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900