DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMXL3 and rsp-4

DIOPT Version :9

Sequence 1:NP_001138818.1 Gene:RBMXL3 / 139804 HGNCID:26859 Length:1067 Species:Homo sapiens
Sequence 2:NP_001379856.1 Gene:rsp-4 / 173915 WormBaseID:WBGene00004701 Length:196 Species:Caenorhabditis elegans


Alignment Length:182 Identity:55/182 - (30%)
Similarity:81/182 - (44%) Gaps:33/182 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    10 LFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNGKYL 74
            |.|..|:.:|....|:..|.:||.|..|.:.:|:.:.:|:||.||.|....||:.|....:||.:
 Worm    21 LKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKLV 85

Human    75 DGKAIMV--AQTIKPA--------------FKSSRWVPPTPGSGSRSRFSHRTRGGGSSPQRPPS 123
            ||:.:.|  |:..:|:              .:|.|....:| ..||||...|:|   |..:.|||
 Worm    86 DGRELRVTLAKYDRPSDERGGRGGGGGRRRSRSPRRRSRSP-RYSRSRSPRRSR---SRTRSPPS 146

Human   124 QGRPDDGRGYAGYFDLWPYRA--PMPRKRGPPPRHWASPPHKRATPSSLAHS 173
            :.|.|.           |.|.  ...|.|.||||...||..:|:...|.:.|
 Worm   147 RDRRDS-----------PDRRDNSRSRSRSPPPREDGSPKERRSRSRSASRS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMXL3NP_001138818.1 RRM <1..>81 CDD:223796 24/70 (34%)
RRM_RBMX_like 7..86 CDD:240828 26/77 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 15/40 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..175 11/32 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..1067
rsp-4NP_001379856.1 RRM_SRSF2_SRSF8 21..93 CDD:409751 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.