DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMXL3 and rsp-4

DIOPT Version :10

Sequence 1:NP_001138818.1 Gene:RBMXL3 / 139804 HGNCID:26859 Length:1067 Species:Homo sapiens
Sequence 2:NP_001379856.1 Gene:rsp-4 / 173915 WormBaseID:WBGene00004701 Length:196 Species:Caenorhabditis elegans


Alignment Length:182 Identity:55/182 - (30%)
Similarity:81/182 - (44%) Gaps:33/182 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    10 LFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNGKYL 74
            |.|..|:.:|....|:..|.:||.|..|.:.:|:.:.:|:||.||.|....||:.|....:||.:
 Worm    21 LKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKLV 85

Human    75 DGKAIMV--AQTIKPA--------------FKSSRWVPPTPGSGSRSRFSHRTRGGGSSPQRPPS 123
            ||:.:.|  |:..:|:              .:|.|....:| ..||||...|:|   |..:.|||
 Worm    86 DGRELRVTLAKYDRPSDERGGRGGGGGRRRSRSPRRRSRSP-RYSRSRSPRRSR---SRTRSPPS 146

Human   124 QGRPDDGRGYAGYFDLWPYRA--PMPRKRGPPPRHWASPPHKRATPSSLAHS 173
            :.|.|.           |.|.  ...|.|.||||...||..:|:...|.:.|
 Worm   147 RDRRDS-----------PDRRDNSRSRSRSPPPREDGSPKERRSRSRSASRS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMXL3NP_001138818.1 RRM_RBMX_like 7..86 CDD:409816 26/77 (34%)
PABP-1234 <10..206 CDD:130689 55/182 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 15/40 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..175 11/32 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..1067
rsp-4NP_001379856.1 RRM_SRSF2_SRSF8 21..93 CDD:409751 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.