DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RBMXL3 and Y25C1A.8

DIOPT Version :9

Sequence 1:	NP_001138818.1	Gene:	RBMXL3 / 139804	HGNCID:	26859	Length:	1067	Species:	Homo sapiens
Sequence 2:	NP_494440.1	Gene:	Y25C1A.8 / 173655	WormBaseID:	WBGene00021295	Length:	345	Species:	Caenorhabditis elegans

Alignment Length:	145	Identity:	31/145 - (21%)
Similarity:	45/145 - (31%)	Gaps:	58/145 - (40%)

- Green bases have known domain annotations that are detailed below.

Human   950 EEYRGPSPDAHSG-----GRDSSIKSYG---------------------------------LSDR 976
            :||..|.|.|.|.     |::.:.||.|                                 |..|
Worm    40 DEYGKPKPRAKSKIGKELGKEQAEKSKGLFAAEDWVCSKCGNVNWARRRTCNVCNAPKLADLERR 104

Human   977 YGGGGHYEEYQGSLPDAYSGDHDRSSNSYGRSDRYSRGRDRVGRPDRGLPLPMETGSP------P 1035
            .|.||.|.:.|.  .:....|:|...:.:||..: .:|.|:.        ..||.|..      .
Worm   105 TGYGGGYNDRQN--VEYVKRDYDEEFDEFGRKKK-KKGEDQF--------RDMEEGEASDDEEIA 158

Human  1036 LHDSYSRSGCRVPRG 1050
            :.|...:   |.|||
Worm   159 VKDDLKK---RTPRG 170

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RBMXL3	NP_001138818.1	RRM	<1..>81	CDD:223796
		RRM_RBMX_like	7..86	CDD:240828
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	90..131
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	144..175
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	267..305
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	357..1067		31/145 (21%)
Y25C1A.8	NP_494440.1	RanBP2-type Zn finger	21..42	CDD:275375	0/1 (0%)
		ZnF_RBZ	72..96	CDD:197784	0/23 (0%)
		RanBP2-type Zn finger	74..93	CDD:275375	0/18 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910