DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RBMXL3 and R06C1.4

DIOPT Version :9

Sequence 1:	NP_001138818.1	Gene:	RBMXL3 / 139804	HGNCID:	26859	Length:	1067	Species:	Homo sapiens
Sequence 2:	NP_493029.1	Gene:	R06C1.4 / 173076	WormBaseID:	WBGene00011059	Length:	84	Species:	Caenorhabditis elegans

Alignment Length:	72	Identity:	23/72 - (31%)
Similarity:	40/72 - (55%)	Gaps:	0/72 - (0%)

- Green bases have known domain annotations that are detailed below.

Human    10 LFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAAARDMNGKYL 74
            :::|.:..:..|:.:...|...||:..|.::.||:|.:.||||||.|...|.|:.|...:||...
Worm     8 VYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEEAGAQRAVEQLNGVAF 72

Human    75 DGKAIMV 81
            :|:.:.|
Worm    73 NGRNLRV 79

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RBMXL3	NP_001138818.1	RRM	<1..>81	CDD:223796	22/70 (31%)
		RRM_RBMX_like	7..86	CDD:240828	23/72 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	90..131
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	144..175
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	267..305
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	357..1067
R06C1.4	NP_493029.1	RRM_SF	9..84	CDD:388407	23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910