DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRK and crk

DIOPT Version :9

Sequence 1:NP_058431.2 Gene:CRK / 1398 HGNCID:2362 Length:304 Species:Homo sapiens
Sequence 2:NP_001006107.1 Gene:crk / 448023 XenbaseID:XB-GENE-996357 Length:296 Species:Xenopus tropicalis


Alignment Length:305 Identity:260/305 - (85%)
Similarity:279/305 - (91%) Gaps:10/305 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINS- 64
            ||||||||:|:|||||:|:|||||.|||||||||||||||:|.||||||||||||:|||||||| 
 Frog     1 MAGNFDSEDRASWYWGKLNRQEAVNLLQGQRHGVFLVRDSTTIPGDYVLSVSENSKVSHYIINSV 65

Human    65 SGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVIL 129
            |..|        |...|:..||.|||||||||||:||||||||||||||||||||:|:| ||||.
 Frog    66 SNNR--------QSGTGMIQSRFRIGDQEFDSLPSLLEFYKIHYLDTTTLIEPVSKSKQ-SGVIQ 121

Human   130 RQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPAS 194
            ||||.|||||||||||||:||||||||||||||||||||||||||::|:||||||||||||||.|
 Frog   122 RQEEVEYVRALFDFNGNDDEDLPFKKGDILRIRDKPEEQWWNAEDNDGRRGMIPVPYVEKYRPPS 186

Human   195 ASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALE 259
            ::.|||||||||.|||||||||||||||||||||||||||||||:||||||||||||||||||||
 Frog   187 SAGSALIGGNQENSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIFARVIQKRVPNAYDKTALALE 251

Human   260 VGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS 304
            ||:||||||||||||||||||||.||||||||||||||||:||||
 Frog   252 VGDLVKVTKINVSGQWEGECNGKYGHFPFTHVRLLDQQNPEEDFS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRKNP_058431.2 SH2_CRK_like 5..122 CDD:198180 89/117 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..85 8/24 (33%)
SH3_CRK_N 135..189 CDD:212692 49/53 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..229 26/27 (96%)
SH3_CRK_C 237..293 CDD:212693 52/55 (95%)
crkNP_001006107.1 SH2_CRK_like 5..115 CDD:198180 89/117 (76%)
SH3_CRK_N 127..181 CDD:212692 49/53 (92%)
SH3_CRK_C 229..285 CDD:212693 52/55 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I24452
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H81850
Inparanoid 1 1.050 528 1.000 Inparanoid score I7333
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1414461at2759
OrthoFinder 1 1.000 - - FOG0003539
OrthoInspector 1 1.000 - - oto157040
Panther 1 1.100 - - LDO PTHR19969
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.160

Return to query results.
Submit another query.