DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTRT1 and actrt2

DIOPT Version :9

Sequence 1:NP_612146.1 Gene:ACTRT1 / 139741 HGNCID:24027 Length:376 Species:Homo sapiens
Sequence 2:NP_001006111.1 Gene:actrt2 / 448563 XenbaseID:XB-GENE-22041684 Length:375 Species:Xenopus tropicalis


Alignment Length:366 Identity:169/366 - (46%)
Similarity:251/366 - (68%) Gaps:1/366 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    10 PAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCK-FNVPLARLNQKYFVGQEALYKYEALHLHYP 73
            ||||||.|||.||||:|||..|..|:.||:||.. .:..|....|.|:||:.|:.|...|.|.:|
 Frog    10 PAVIFDIGSGNCKAGMSGEDLPTAVVPSVVGHLSDRSAMLGAGQQPYYVGEMAMSKRAILDLVFP 74

Human    74 IERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFETFSVPGFYLS 138
            |:.|:|..||:|.|:||:|::.||....|:.||.:||..|||...|.|:||:.||.|:||..|:|
 Frog    75 IKEGIVKSWDNMIKIWKYLYKYELKKPSSEHPVFLTEAPLNPLRNRHKMAEIFFENFNVPAMYVS 139

Human   139 NHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASGFNF 203
            :.|..|||||...||:|:|.|.|:|.||.|::|.:|||||:||.:|||.||::|.:||..:|:||
 Frog   140 HQANLALYASGLTTGIVLDVGAGITHTVAIYDGVALPHAVSKLPVAGRTITQYLMKLLTENGYNF 204

Human   204 PCILNKAVVNNIKEKLCYIALEPEKELRKSRGEVLGAYRLPDGHVIHFGDELYQVPEVLFAPDQL 268
            .....:.:|.:||||||||||:|..|..::..::...|.||||:||....:|::.||.||:|..:
 Frog   205 ITAAEREIVRDIKEKLCYIALDPSAEYERNPKDITKEYTLPDGNVIKIDSQLFRAPEALFSPSNI 269

Human   269 GIHSPGLSKMVSSSIMKCDTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITAS 333
            |:.:||:..::::.|.||..||:..|.:::|||||:||.||.:||:::|:|:.|..|..||:.|:
 Frog   270 GLEAPGVQGLINNIIQKCPIDIRRALLSNVVLSGGSTLFPGFDERVLRELEKKAPDGVQIKVLAA 334

Human   334 PDRCFSAWIGASIMTSMSSFKQMWVTSADFKEYGTSVVQRR 374
            .||.:|.|||||:::||.|||:.|:..:::.|:|.|:|.::
 Frog   335 TDRKYSVWIGASVLSSMDSFKENWIRKSEYDEFGPSIVHQK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTRT1NP_612146.1 ACTIN 9..376 CDD:214592 169/366 (46%)
actrt2NP_001006111.1 ACTIN 9..375 CDD:214592 169/364 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG41398
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.