DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTRT1 and Act5C

DIOPT Version :9

Sequence 1:NP_612146.1 Gene:ACTRT1 / 139741 HGNCID:24027 Length:376 Species:Homo sapiens
Sequence 2:NP_001014725.1 Gene:Act5C / 31521 FlyBaseID:FBgn0000042 Length:376 Species:Drosophila melanogaster


Alignment Length:372 Identity:180/372 - (48%)
Similarity:255/372 - (68%) Gaps:3/372 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     8 DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYEALHLH 71
            :|.|::.|||||:||||.:|:..||.|..|::|..:....:..:.|| .:||.||..|...|.|.
  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 69

Human    72 YPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFETFSVPGFY 136
            ||||.|:||.||||||:|.|.|..||.|.|.:.|||:||..|||:..|||:.::|||||:.|..|
  Fly    70 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 134

Human   137 LSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASGF 201
            ::..||.:||||...||:|:||||||:.||||:|||:||||:.:|.:||||:|::|.::|...|:
  Fly   135 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGY 199

Human   202 NFPCILNKAVVNNIKEKLCYIALEPEKEL--RKSRGEVLGAYRLPDGHVIHFGDELYQVPEVLFA 264
            :|.....:.:|.:|||||||:||:.|:|:  ..|...:..:|.||||.||..|:|.::.||.||.
  Fly   200 SFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQ 264

Human   265 PDQLGIHSPGLSKMVSSSIMKCDTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIK 329
            |..||:.:.|:.:...:||||||.||:..|||:.|||||||:.||:.:|:.||:..||.....||
  Fly   265 PSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 329

Human   330 ITASPDRCFSAWIGASIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376
            |.|.|:|.:|.|||.||:.|:|:|:|||::..::.|.|.|:|.|:||
  Fly   330 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTRT1NP_612146.1 ACTIN 9..376 CDD:214592 178/369 (48%)
Act5CNP_001014725.1 PTZ00281 1..376 CDD:173506 178/370 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.