| Sequence 1: | NP_001129745.1 | Gene: | ZFP92 / 139735 | HGNCID: | 12865 | Length: | 416 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_012479.1 | Gene: | ZAP1 / 853390 | SGDID: | S000003592 | Length: | 880 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 219 | Identity: | 70/219 - (31%) |
|---|---|---|---|
| Similarity: | 100/219 - (45%) | Gaps: | 53/219 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Human 169 KHRIIHSGEKPYACPECGKLFRRSFALLEHQRIHSGEKPYACPE--------------------- 212
Human 213 ----CSKTFTRSSNLIKH-QVIH--SGERPFAC--GDCGKLFRRSFALLEHARVHSGERPYACPE 268
Human 269 CGKAFSRSSNLIEHQRTHRGEKPYACGQCAKAFKGVSQLIHHQRSHSGERPFACRECGKAFRGRS 333
Human 334 GLSQHRRVHSGEKPYECSDCGKAF 357 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ZFP92 | NP_001129745.1 | KRAB | 14..74 | CDD:214630 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 86..125 | ||||
| COG5048 | <145..286 | CDD:227381 | 33/146 (23%) | ||
| C2H2 Zn finger | 154..174 | CDD:275368 | 2/4 (50%) | ||
| C2H2 Zn finger | 182..202 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 210..230 | CDD:275368 | 6/45 (13%) | ||
| C2H2 Zn finger | 238..258 | CDD:275368 | 6/21 (29%) | ||
| COG5048 | 262..>315 | CDD:227381 | 24/52 (46%) | ||
| C2H2 Zn finger | 266..286 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 294..314 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 322..342 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 335..359 | CDD:404364 | 12/23 (52%) | ||
| C2H2 Zn finger | 350..370 | CDD:275368 | 6/8 (75%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 368..416 | ||||
| ZAP1 | NP_012479.1 | COG5048 | 292..761 | CDD:227381 | 21/117 (18%) |
| C2H2 Zn finger | 743..762 | CDD:275368 | 5/18 (28%) | ||
| SUF4-like | 766..>814 | CDD:411020 | 22/47 (47%) | ||
| C2H2 Zn finger | 770..795 | CDD:411020 | 11/24 (46%) | ||
| C2H2 Zn finger | 770..790 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 798..818 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 810..834 | CDD:404364 | 11/23 (48%) | ||
| C2H2 Zn finger | 826..846 | CDD:275368 | 9/19 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||