DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRIP2 and Mlp84B

DIOPT Version :9

Sequence 1:NP_001257766.1 Gene:CRIP2 / 1397 HGNCID:2361 Length:282 Species:Homo sapiens
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:191 Identity:64/191 - (33%)
Similarity:82/191 - (42%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    89 AEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEK 153
            ||::.:.|:.|||.|.||..|.|.|......|...|....|.|||..|||||...|..|..:...
  Fly   130 AEQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGALQSD 194

Human   154 PLAE---GPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTS 215
            ..|.   .||:...|:|...:|.      |.:|                ||||...||.||:..|
  Fly   195 CYAHDDGAPQIRAAIDVDKIQAR------PGEG----------------CPRCGGVVYAAEQKLS 237

Human   216 LGKDWHRPCLRCERCGKTLTPGGHAE-HDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRD 275
            .|::||:.|..|:.|.|||.....:: .|...|| :.|||..:||.|... |.||.....|
  Fly   238 KGREWHKKCFNCKDCHKTLDSINASDGPDRDVYC-RTCYGKKWGPHGYGF-ACGSGFLQTD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRIP2NP_001257766.1 LIM 89..132 CDD:295319 15/42 (36%)
LIM_TLP_like 200..253 CDD:188785 21/53 (40%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788
LIM_CRP_like 120..173 CDD:188712 15/42 (36%)
LIM_CRP_like 222..275 CDD:188712 21/53 (40%)
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.