DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRIP1 and Mlp84B

DIOPT Version :9

Sequence 1:NP_001302.1 Gene:CRIP1 / 1396 HGNCID:2360 Length:77 Species:Homo sapiens
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:68 Identity:32/68 - (47%)
Similarity:40/68 - (58%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     2 PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGF 66
            ||||:|.|.||.||...:.|..:|:.|.||..|.|:|.|....|||.:.||. .|:...|||||:
  Fly    10 PKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCK-TCHGRKFGPKGY 73

Human    67 GRG 69
            |.|
  Fly    74 GFG 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRIP1NP_001302.1 LIM_CRIP 4..57 CDD:188862 22/52 (42%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 23/53 (43%)
LIM_CRP_like 120..173 CDD:188712
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.