Sequence 1: | NP_001240758.1 | Gene: | PTPDC1 / 138639 | HGNCID: | 30184 | Length: | 808 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_594716.1 | Gene: | clp1 / 2542358 | PomBaseID: | SPAC1782.09c | Length: | 537 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 260 | Identity: | 55/260 - (21%) |
---|---|---|---|
Similarity: | 94/260 - (36%) | Gaps: | 91/260 - (35%) |
- Green bases have known domain annotations that are detailed below.
Human 91 YTKVGERLRHVIPGHMACSMAC-----------------------------GGRA---------- 116
Human 117 CKYENPARWSEQEQAIKGVYS-----------------SWVTDNILAMARP-----------SSE 153
Human 154 LLEKYHII-DQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYG 217
Human 218 VASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSI 282
Human 283 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PTPDC1 | NP_001240758.1 | PTPc_motif | 208..289 | CDD:214649 | 24/75 (32%) |
clp1 | NP_594716.1 | DSPn | 17..155 | CDD:291343 | 12/73 (16%) |
CDC14 | 178..353 | CDD:225297 | 40/163 (25%) | ||
PTPc | <255..332 | CDD:304379 | 24/70 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1720 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |