DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPDC1 and clp1

DIOPT Version :9

Sequence 1:NP_001240758.1 Gene:PTPDC1 / 138639 HGNCID:30184 Length:808 Species:Homo sapiens
Sequence 2:NP_594716.1 Gene:clp1 / 2542358 PomBaseID:SPAC1782.09c Length:537 Species:Schizosaccharomyces pombe


Alignment Length:260 Identity:55/260 - (21%)
Similarity:94/260 - (36%) Gaps:91/260 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    91 YTKVGERLRHVIPGHMACSMAC-----------------------------GGRA---------- 116
            |:....|||    .:.||.:||                             .|.|          
pombe    88 YSSTDTRLR----ANAACLLACYMVLVQNWPPHLALAPLAQAEPPFLGFRDAGYAVSDYYITIQD 148

Human   117 CKYENPARWSEQEQAIKGVYS-----------------SWVTDNILAMARP-----------SSE 153
            |.|   ..|..:|.:|..:.:                 :|::...:|.|.|           ..:
pombe   149 CVY---GLWRARESSILNIRNIDVHDYETYERVENGDFNWISPKFIAFASPIQAGWNHASTRPKK 210

Human   154 LLEKYHII-DQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYG 217
            |.:.:.|: |.|:::.:|.|:.|..|                .|..:.|...||......::|..
pombe   211 LPQPFAIVLDYFVANKVKLIVRLNGP----------------LYDKKTFENVGIRHKEMYFEDGT 259

Human   218 VASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSI 282
            |..|:.:.:.:.:.....::|.:|:||.|||||||.||..||::....||::.|.::|..||..:
pombe   260 VPELSLVKEFIDLTEEVEEDGVIAVHCKAGLGRTGCLIGAYLIYKHCFTANEVIAYMRIMRPGMV 324

Human   283  282
            pombe   325  324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPDC1NP_001240758.1 PTPc_motif 208..289 CDD:214649 24/75 (32%)
clp1NP_594716.1 DSPn 17..155 CDD:291343 12/73 (16%)
CDC14 178..353 CDD:225297 40/163 (25%)
PTPc <255..332 CDD:304379 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.