DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATF2 and Jra

DIOPT Version :9

Sequence 1:NP_001243019.1 Gene:ATF2 / 1386 HGNCID:784 Length:505 Species:Homo sapiens
Sequence 2:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster


Alignment Length:396 Identity:86/396 - (21%)
Similarity:141/396 - (35%) Gaps:83/396 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   131 TTHQDSPLPHP---ESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSP 192
            |..|..|...|   |...|.:.:.|...|:.| :...||.||.:.:  .::.:..:.....:.||
  Fly    22 TAIQIIPKTEPVGEEGPMSLDFQSPNLNTSTP-NPNKRPGSLDLNS--KSAKNKRIFAPLVINSP 83

Human   193 TSSTVITQAP-------SSNRPIVPVPGP-FP------LLLHLPNGQTMPVAIPASITSSNVHVP 243
            ..|:.....|       |:|....|.||. ||      .:..|..|:....|:....|:|...  
  Fly    84 DLSSKTVNTPDLEKILLSNNLMQTPQPGKVFPTKAGPVTVEQLDFGRGFEEALHNLHTNSQAF-- 146

Human   244 AAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSE 308
                                ||:.....|.|.....||:|    .|.||.:    |.....|...
  Fly   147 --------------------PSANSAANSAANNTTAAAMT----AVNNGIS----GGTFTYTNMT 183

Human   309 ESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKR 373
            |.......:|....:....:|.....|.:....|:|               :|||.|||:||:::
  Fly   184 EGFSVIKDEPVNQASSPTVNPIDMEAQEKIKLERKR---------------QRNRVAASKCRKRK 233

Human   374 KVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAH--KDCPV-------TAMQKKSGY 429
            ...:..||.:.:.|...|..|.|.|..|::.||||||.::.|  ..|.|       ..::..:|.
  Fly   234 LERISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQXHLELSAGE 298

Human   430 HTADKDDSSEDISVPSSPH-------TEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEP 487
            :  |::|.:.:...||:|.       .|....:|........|.|:..::..|.|.:....:.:|
  Fly   299 N--DEEDVALETETPSNPEDPEQPMPLEFFSSASTGALELEGSASQDISLTNSELLEEESDNEQP 361

Human   488 ALSQIV 493
            .:..|:
  Fly   362 LVLYIL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATF2NP_001243019.1 Nuclear export signal 1 (N-NES) 1..7
C2H2 Zn finger 27..49 CDD:275370
GCN4_cent 65..102 CDD:213399
Herpes_BLLF1 <90..342 CDD:282904 45/227 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..155 7/26 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..373 26/113 (23%)
Essential for its histone acetyltransferase activity 296..299 0/2 (0%)
bZIP_ATF2 354..414 CDD:269835 22/59 (37%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 354..374 8/19 (42%)
coiled coil 355..406 CDD:269835 16/50 (32%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 380..408 10/27 (37%)
Nuclear export signal 2 (C-NES) 405..414 6/8 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..472 10/53 (19%)
JraNP_001260844.1 Jun <76..>144 CDD:281890 15/67 (22%)
bZIP_Jun 214..274 CDD:269844 24/74 (32%)
coiled coil 215..266 CDD:269844 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.