DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Epm2a and CG10089

DIOPT Version :10

Sequence 1:NP_034276.2 Gene:Epm2a / 13853 MGIID:1341085 Length:330 Species:Mus musculus
Sequence 2:NP_648654.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:170 Identity:38/170 - (22%)
Similarity:66/170 - (38%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   157 SRILPNIWLGSCPRQLEHVTI---KLKHELGVTAVMNFQTEWDIIQNSSGCNRYPEPMTPDTMMK 218
            :::||.:::|:.....:|..:   |:.|.:.:                   :..|..:.||   |
  Fly     6 NKVLPGLYVGNYRDSKDHAQLERFKISHIIAI-------------------HDSPRRLLPD---K 48

Mouse   219 LYKEEGLSYIWMPTPDMSTEGRVQMLPQ--AVC--LLHALLENGHTVYVHCNAGVGRSTAAVCGW 279
            .|    |..:...|||       |.|.|  :||  .:||.......|.:||.||:.||......:
  Fly    49 HY----LCVMASDTPD-------QNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAY 102

Mouse   280 LHYVIGWNLRKVQYFIMAKRPAVYIDEDALAQAQ-QDFSQ 318
            :......|.::....:.|.|...  :.:|..|:| |:|.|
  Fly   103 IMTATHLNWKEALKVVRAGRAVA--NPNAGFQSQLQEFEQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Epm2aNP_034276.2 CBM20_laforin 1..128 CDD:99881
DSP_laforin-like 154..311 CDD:350375 33/160 (21%)
Glucan phosphatase signature motif CXAGXGR. /evidence=ECO:0000250|UniProtKB:O95278 265..271 3/5 (60%)
CG10089NP_648654.1 DSP_DUSP22_15 5..140 CDD:350369 37/168 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.