DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Enah and ena

DIOPT Version :10

Sequence 1:XP_030102994.1 Gene:Enah / 13800 MGIID:108360 Length:860 Species:Mus musculus
Sequence 2:NP_001137709.1 Gene:ena / 37201 FlyBaseID:FBgn0000578 Length:980 Species:Drosophila melanogaster


Alignment Length:181 Identity:37/181 - (20%)
Similarity:54/181 - (29%) Gaps:67/181 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 ERQHRCEDCDQLFESKAELADHQKF--PCSTPHSAFSMVEEDLQQNLESESDLREIHGNQDCKEC 80
            :.::..|:||.|  ...:..|..:.  |.||||                            |:..
  Fly    62 DSKYLTENCDYL--HNVDCGDRTQLEPPISTPH----------------------------CERL 96

Mouse    81 DRVFPDLQSLEKHMLSHTEEREYKCD---QCPKAFNWKSNLIRHQMSHDSGKHYECENC--AKQV 140
            ..:|.|..               |||   .|     |.....|:|.|.......|...|  |.||
  Fly    97 YGIFADAA---------------KCDVFWNC-----WNGEASRYQCSPGLAYDREARVCMWADQV 141

Mouse   141 FTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFIC 191
                    ...:::.| |...|||..|: .:.:....:|.|.....|.:||
  Fly   142 --------PECKNEEV-ANGFACPAAGE-ISNAGSFSRHAHPEDCRKYYIC 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EnahXP_030102994.1 EVH1_Ena_VASP-like 36..143 CDD:269918 22/113 (19%)
PHA03247 <356..576 CDD:223021
WH2_hVASP-like 654..680 CDD:409225
actin-binding sequence 670..673 CDD:409225
VASP_tetra 822..856 CDD:462599
enaNP_001137709.1 EVH1_Ena_VASP-like 301..408 CDD:269918
VASP_tetra 946..979 CDD:462599
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.